Pongo abelii (Sumatran orangutan): 100173870 Help Entry 100173870         CDS       T01416                                  Symbol CD59 Name (RefSeq) CD59 glycoprotein precursor   KO K04008   CD59 antigen Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04610   Complement and coagulation cascades pon04640   Hematopoietic cell lineage Brite KEGG Orthology (KO) [BR:pon00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100173870 (CD59)    04610 Complement and coagulation cascades     100173870 (CD59)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pon04147]     100173870 (CD59)    04090 CD molecules [BR:pon04090]     100173870 (CD59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]     100173870 (CD59) Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100173870 (CD59)   Exosomal proteins of other body fluids (saliva and urine)    100173870 (CD59)   Exosomal proteins of colorectal cancer cells    100173870 (CD59) CD molecules [BR:pon04090]  Proteins   100173870 (CD59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]  Antigens   100173870 (CD59) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Motif Other DBs NCBI-GeneID:  100173870 NCBI-ProteinID:  NP_001126861 Ensembl:  ENSPPYG00000003370 UniProt:  Q5R510 A0A2J8WG29 LinkDB All DBs Position 9:33491054..33517695 Genome browser AA seq 128 aa AA seqDB search MGIQGGSVLFGLLLILAVFCHSGHSLQCYSCPNPTADCKTAVNCSSGFDACLITKAGLRV YNQCWKFEHCTFNEVTTRLKESELTYHCCKKDLCNINEQLENGGTSLSEKTVLLLVTPFL AAAWSLHP NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgggaatccaaggagggtctgtcctgttcgggctgctgctcatcctggctgtcttctgc cattcgggtcatagcctgcagtgctacagctgtcctaacccaactgctgactgcaaaaca gctgtcaattgttcatctggttttgatgcgtgtctcattaccaaagctgggttacgagtg tataaccagtgttggaaatttgagcattgcactttcaacgaggttacaacccgcttgaag gaaagtgagctaacgtaccactgctgcaagaaggacctgtgtaacattaacgaacagctt gaaaatggtgggacatccttatcagagaaaacagttcttctgctggtgactccatttctg gcagcagcctggagccttcatccctaa

DBGET integrated database retrieval system