Pongo abelii (Sumatran orangutan): 100174095 Help Entry 100174095         CDS       T01416                                  Symbol MT2A Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04978   Mineral absorption Brite KEGG Orthology (KO) [BR:pon00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     100174095 (MT2A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pon03019]     100174095 (MT2A)    03029 Mitochondrial biogenesis [BR:pon03029]     100174095 (MT2A) Messenger RNA biogenesis [BR:pon03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100174095 (MT2A) Mitochondrial biogenesis [BR:pon03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     100174095 (MT2A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  100174095 NCBI-ProteinID:  NP_001127065 Ensembl:  ENSPPYG00000038311 UniProt:  Q5NVS0 A0A2J8VYS4 LinkDB All DBs Position 18:55858846..55859756 Genome browser AA seq 61 aa AA seqDB search MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcccaactgctcctgcgccgccggtgactcctgcacctgcgccggctcctgcaaa tgcaaagagtgcaagtgcacctcctgcaagaaaagctgctgctcctgctgccctgtgggc tgtgccaagtgtgcccagggctgcatctgcaaaggggcgtcggacaagtgcagctgctgc gcctga

DBGET integrated database retrieval system