Pongo abelii (Sumatran orangutan): 100174155 Help Entry 100174155         CDS       T01416                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04814   Motor proteins pon05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pon00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     100174155 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100174155 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pon03037]     100174155 (DYNLT3)    04812 Cytoskeleton proteins [BR:pon04812]     100174155 (DYNLT3) Cilium and associated proteins [BR:pon03037]  Motile cilia and associated proteins   Dynein arm    100174155 (DYNLT3) Cytoskeleton proteins [BR:pon04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      100174155 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  100174155 NCBI-ProteinID:  NP_001127114 Ensembl:  ENSPPYG00000020241 UniProt:  Q5NVF5 A0A2J8WIZ3 LinkDB All DBs Position X:complement(38055696..38064411) Genome browser AA seq 116 aa AA seqDB search MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGK AYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccatcgccactgcgacgaggttggcttcaatgctgaggaagcccacaat attgtcaaagagtgtgtagatggggttttaggtggtgaagattataatcacaacaacatc aaccagtggaccgcaagcatagtggaacaatccttaacacatctggttaagttgggaaaa gcttataaatatattgtgacctgtgcagtggtccagaagagcgcatatggctttcacaca gccagctcctgtttttgggataccacatctgatggaacctgtaccgtaagatgggagaac cggaccatgaactgtattgtcaatgtttttgccattgctattgttctttaa

DBGET integrated database retrieval system