Pongo abelii (Sumatran orangutan): 100174317 Help Entry 100174317         CDS       T01416                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon01521   EGFR tyrosine kinase inhibitor resistance pon01522   Endocrine resistance pon04010   MAPK signaling pathway pon04012   ErbB signaling pathway pon04014   Ras signaling pathway pon04015   Rap1 signaling pathway pon04062   Chemokine signaling pathway pon04068   FoxO signaling pathway pon04071   Sphingolipid signaling pathway pon04072   Phospholipase D signaling pathway pon04137   Mitophagy - animal pon04140   Autophagy - animal pon04150   mTOR signaling pathway pon04151   PI3K-Akt signaling pathway pon04210   Apoptosis pon04211   Longevity regulating pathway pon04213   Longevity regulating pathway - multiple species pon04218   Cellular senescence pon04360   Axon guidance pon04370   VEGF signaling pathway pon04371   Apelin signaling pathway pon04540   Gap junction pon04550   Signaling pathways regulating pluripotency of stem cells pon04625   C-type lectin receptor signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon04660   T cell receptor signaling pathway pon04662   B cell receptor signaling pathway pon04664   Fc epsilon RI signaling pathway pon04714   Thermogenesis pon04720   Long-term potentiation pon04722   Neurotrophin signaling pathway pon04725   Cholinergic synapse pon04726   Serotonergic synapse pon04730   Long-term depression pon04810   Regulation of actin cytoskeleton pon04910   Insulin signaling pathway pon04912   GnRH signaling pathway pon04915   Estrogen signaling pathway pon04916   Melanogenesis pon04917   Prolactin signaling pathway pon04919   Thyroid hormone signaling pathway pon04921   Oxytocin signaling pathway pon04926   Relaxin signaling pathway pon04929   GnRH secretion pon04933   AGE-RAGE signaling pathway in diabetic complications pon04935   Growth hormone synthesis, secretion and action pon05010   Alzheimer disease pon05022   Pathways of neurodegeneration - multiple diseases pon05034   Alcoholism pon05160   Hepatitis C pon05161   Hepatitis B pon05163   Human cytomegalovirus infection pon05165   Human papillomavirus infection pon05166   Human T-cell leukemia virus 1 infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05170   Human immunodeficiency virus 1 infection pon05200   Pathways in cancer pon05203   Viral carcinogenesis pon05205   Proteoglycans in cancer pon05206   MicroRNAs in cancer pon05207   Chemical carcinogenesis - receptor activation pon05208   Chemical carcinogenesis - reactive oxygen species pon05210   Colorectal cancer pon05211   Renal cell carcinoma pon05213   Endometrial cancer pon05214   Glioma pon05215   Prostate cancer pon05216   Thyroid cancer pon05218   Melanoma pon05219   Bladder cancer pon05220   Chronic myeloid leukemia pon05221   Acute myeloid leukemia pon05223   Non-small cell lung cancer pon05224   Breast cancer pon05225   Hepatocellular carcinoma pon05226   Gastric cancer pon05230   Central carbon metabolism in cancer pon05231   Choline metabolism in cancer pon05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100174317 (NRAS)    04015 Rap1 signaling pathway     100174317 (NRAS)    04068 FoxO signaling pathway     100174317 (NRAS)    04072 Phospholipase D signaling pathway     100174317 (NRAS)    04071 Sphingolipid signaling pathway     100174317 (NRAS)    04151 PI3K-Akt signaling pathway     100174317 (NRAS)    04150 mTOR signaling pathway     100174317 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100174317 (NRAS)    04137 Mitophagy - animal     100174317 (NRAS)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100174317 (NRAS)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     100174317 (NRAS)    04660 T cell receptor signaling pathway     100174317 (NRAS)    04662 B cell receptor signaling pathway     100174317 (NRAS)    04664 Fc epsilon RI signaling pathway     100174317 (NRAS)    04062 Chemokine signaling pathway     100174317 (NRAS)   09152 Endocrine system    04929 GnRH secretion     100174317 (NRAS)    04915 Estrogen signaling pathway     100174317 (NRAS)    04917 Prolactin signaling pathway     100174317 (NRAS)    04921 Oxytocin signaling pathway     100174317 (NRAS)    04926 Relaxin signaling pathway     100174317 (NRAS)    04935 Growth hormone synthesis, secretion and action     100174317 (NRAS)    04919 Thyroid hormone signaling pathway     100174317 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     100174317 (NRAS)    04726 Serotonergic synapse     100174317 (NRAS)    04720 Long-term potentiation     100174317 (NRAS)    04730 Long-term depression     100174317 (NRAS)    04722 Neurotrophin signaling pathway     100174317 (NRAS)   09158 Development and regeneration    04360 Axon guidance     100174317 (NRAS)   09149 Aging    04211 Longevity regulating pathway     100174317 (NRAS)    04213 Longevity regulating pathway - multiple species     100174317 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     100174317 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100174317 (NRAS)    05206 MicroRNAs in cancer     100174317 (NRAS)    05205 Proteoglycans in cancer     100174317 (NRAS)    05207 Chemical carcinogenesis - receptor activation     100174317 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     100174317 (NRAS)    05203 Viral carcinogenesis     100174317 (NRAS)    05230 Central carbon metabolism in cancer     100174317 (NRAS)    05231 Choline metabolism in cancer     100174317 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100174317 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     100174317 (NRAS)    05225 Hepatocellular carcinoma     100174317 (NRAS)    05226 Gastric cancer     100174317 (NRAS)    05214 Glioma     100174317 (NRAS)    05216 Thyroid cancer     100174317 (NRAS)    05221 Acute myeloid leukemia     100174317 (NRAS)    05220 Chronic myeloid leukemia     100174317 (NRAS)    05218 Melanoma     100174317 (NRAS)    05211 Renal cell carcinoma     100174317 (NRAS)    05219 Bladder cancer     100174317 (NRAS)    05215 Prostate cancer     100174317 (NRAS)    05213 Endometrial cancer     100174317 (NRAS)    05224 Breast cancer     100174317 (NRAS)    05223 Non-small cell lung cancer     100174317 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100174317 (NRAS)    05170 Human immunodeficiency virus 1 infection     100174317 (NRAS)    05161 Hepatitis B     100174317 (NRAS)    05160 Hepatitis C     100174317 (NRAS)    05163 Human cytomegalovirus infection     100174317 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     100174317 (NRAS)    05165 Human papillomavirus infection     100174317 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     100174317 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     100174317 (NRAS)   09165 Substance dependence    05034 Alcoholism     100174317 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100174317 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100174317 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100174317 (NRAS)    01522 Endocrine resistance     100174317 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100174317 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pon04147]     100174317 (NRAS)    04031 GTP-binding proteins [BR:pon04031]     100174317 (NRAS) Membrane trafficking [BR:pon04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     100174317 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     100174317 (NRAS) Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100174317 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    100174317 (NRAS)   Exosomal proteins of breast cancer cells    100174317 (NRAS)   Exosomal proteins of colorectal cancer cells    100174317 (NRAS) GTP-binding proteins [BR:pon04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100174317 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  100174317 NCBI-ProteinID:  NP_001127261 Ensembl:  ENSPPYG00000000997 UniProt:  Q5RD87 LinkDB All DBs Position 1:118019556..118031714 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGLLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac agaaaacaggtggttatagatggtgaaacctgtttgttggacatactggacacagctgga caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcctcctctgt gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt aagcgagtaaaagactcggatgatgtacctatggtgctagtgggaaacaagtgtgatttg ccaacaaggacagttgatacaaaacaagcccatgaactggccaagagttacgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt tgtatgggattgccatgtgtggtgatgtaa

DBGET integrated database retrieval system