KEGG   Pongo abelii (Sumatran orangutan): 100174317
Entry
100174317         CDS       T01416                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04062  Chemokine signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04137  Mitophagy - animal
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04218  Cellular senescence
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04625  C-type lectin receptor signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04714  Thermogenesis
pon04720  Long-term potentiation
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04730  Long-term depression
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04926  Relaxin signaling pathway
pon04929  GnRH secretion
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05034  Alcoholism
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05207  Chemical carcinogenesis - receptor activation
pon05208  Chemical carcinogenesis - reactive oxygen species
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05216  Thyroid cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100174317 (NRAS)
   04015 Rap1 signaling pathway
    100174317 (NRAS)
   04068 FoxO signaling pathway
    100174317 (NRAS)
   04072 Phospholipase D signaling pathway
    100174317 (NRAS)
   04071 Sphingolipid signaling pathway
    100174317 (NRAS)
   04151 PI3K-Akt signaling pathway
    100174317 (NRAS)
   04150 mTOR signaling pathway
    100174317 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100174317 (NRAS)
   04137 Mitophagy - animal
    100174317 (NRAS)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100174317 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100174317 (NRAS)
   04660 T cell receptor signaling pathway
    100174317 (NRAS)
   04662 B cell receptor signaling pathway
    100174317 (NRAS)
   04664 Fc epsilon RI signaling pathway
    100174317 (NRAS)
   04062 Chemokine signaling pathway
    100174317 (NRAS)
  09152 Endocrine system
   04929 GnRH secretion
    100174317 (NRAS)
   04915 Estrogen signaling pathway
    100174317 (NRAS)
   04917 Prolactin signaling pathway
    100174317 (NRAS)
   04921 Oxytocin signaling pathway
    100174317 (NRAS)
   04926 Relaxin signaling pathway
    100174317 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    100174317 (NRAS)
   04919 Thyroid hormone signaling pathway
    100174317 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    100174317 (NRAS)
   04726 Serotonergic synapse
    100174317 (NRAS)
   04720 Long-term potentiation
    100174317 (NRAS)
   04730 Long-term depression
    100174317 (NRAS)
   04722 Neurotrophin signaling pathway
    100174317 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    100174317 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    100174317 (NRAS)
   04213 Longevity regulating pathway - multiple species
    100174317 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    100174317 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174317 (NRAS)
   05206 MicroRNAs in cancer
    100174317 (NRAS)
   05205 Proteoglycans in cancer
    100174317 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    100174317 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    100174317 (NRAS)
   05203 Viral carcinogenesis
    100174317 (NRAS)
   05230 Central carbon metabolism in cancer
    100174317 (NRAS)
   05231 Choline metabolism in cancer
    100174317 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100174317 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100174317 (NRAS)
   05225 Hepatocellular carcinoma
    100174317 (NRAS)
   05226 Gastric cancer
    100174317 (NRAS)
   05214 Glioma
    100174317 (NRAS)
   05216 Thyroid cancer
    100174317 (NRAS)
   05221 Acute myeloid leukemia
    100174317 (NRAS)
   05220 Chronic myeloid leukemia
    100174317 (NRAS)
   05218 Melanoma
    100174317 (NRAS)
   05211 Renal cell carcinoma
    100174317 (NRAS)
   05219 Bladder cancer
    100174317 (NRAS)
   05215 Prostate cancer
    100174317 (NRAS)
   05213 Endometrial cancer
    100174317 (NRAS)
   05224 Breast cancer
    100174317 (NRAS)
   05223 Non-small cell lung cancer
    100174317 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100174317 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    100174317 (NRAS)
   05161 Hepatitis B
    100174317 (NRAS)
   05160 Hepatitis C
    100174317 (NRAS)
   05163 Human cytomegalovirus infection
    100174317 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100174317 (NRAS)
   05165 Human papillomavirus infection
    100174317 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100174317 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    100174317 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    100174317 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100174317 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100174317 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100174317 (NRAS)
   01522 Endocrine resistance
    100174317 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100174317 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100174317 (NRAS)
   04031 GTP-binding proteins [BR:pon04031]
    100174317 (NRAS)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    100174317 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100174317 (NRAS)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100174317 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   100174317 (NRAS)
  Exosomal proteins of breast cancer cells
   100174317 (NRAS)
  Exosomal proteins of colorectal cancer cells
   100174317 (NRAS)
GTP-binding proteins [BR:pon04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100174317 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 100174317
NCBI-ProteinID: NP_001127261
Ensembl: ENSPPYG00000000997
UniProt: Q5RD87
LinkDB
Position
1:118019556..118031714
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGLLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
agaaaacaggtggttatagatggtgaaacctgtttgttggacatactggacacagctgga
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcctcctctgt
gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt
aagcgagtaaaagactcggatgatgtacctatggtgctagtgggaaacaagtgtgatttg
ccaacaaggacagttgatacaaaacaagcccatgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt
tgtatgggattgccatgtgtggtgatgtaa

DBGET integrated database retrieval system