Pongo abelii (Sumatran orangutan): 100189836 Help Entry 100189836         CDS       T01416                                  Name (RefSeq) centrosomal protein 20   KO K16535   lisH domain-containing protein FOPNL Organism pon  Pongo abelii (Sumatran orangutan) Brite KEGG Orthology (KO) [BR:pon00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pon03036]     100189836   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pon03037]     100189836 Chromosome and associated proteins [BR:pon03036]  Eukaryotic type   Centrosome formation proteins    Pericentriolar materials (PCM)     Centriolar satellite      100189836 Cilium and associated proteins [BR:pon03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    100189836 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FOP_dimer Motif Other DBs NCBI-GeneID:  100189836 NCBI-ProteinID:  NP_001128897 Ensembl:  ENSPPYG00000032006 UniProt:  Q5R4V0 LinkDB All DBs Position 10:22189097..22211422 Genome browser AA seq 108 aa AA seqDB search MATVAELKAESGQPVVPLDRQFLVHELNAFEESKDNTIPLLYGILAHFLHGTKDGIQNAF LKGPSLQPSDPSLGRQPSRRKPMDEHLRKEEQKSTNIEELHVSQAVNR NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcgactgtggcggagttgaaggctgaatctggtcaacctgtagttccattggacaga cagtttctcgtccatgaactaaatgcatttgaagaatcaaaggataatacgatacctctt ttatatgggattttagcccatttcttgcatggaactaaggatggcatccagaatgcattt ctgaaagggccttcacttcagccttcagacccaagtcttggcagacaacctagtagaaga aagccaatggatgagcacctaagaaaggaggagcagaaaagtactaacattgaagagctt catgtttctcaggcagtcaacagataa

DBGET integrated database retrieval system