| Entry |
|
|---|
| Symbol |
RAC2
|
|---|
| Name |
(RefSeq) ras-related C3 botulinum toxin substrate 2
|
|---|
| KO |
| K07860 | Ras-related C3 botulinum toxin substrate 2 |
|
|---|
| Organism |
pon Pongo abelii (Sumatran orangutan)
|
|---|
| Pathway |
| pon04613 | Neutrophil extracellular trap formation |
| pon04650 | Natural killer cell mediated cytotoxicity |
| pon04662 | B cell receptor signaling pathway |
| pon04664 | Fc epsilon RI signaling pathway |
| pon04666 | Fc gamma R-mediated phagocytosis |
| pon04670 | Leukocyte transendothelial migration |
| pon04810 | Regulation of actin cytoskeleton |
| pon05163 | Human cytomegalovirus infection |
| pon05170 | Human immunodeficiency virus 1 infection |
| pon05418 | Fluid shear stress and atherosclerosis |
|
|---|
| Brite |
KEGG Orthology (KO) [BR:pon00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
100431483 (RAC2)
04014 Ras signaling pathway
100431483 (RAC2)
04015 Rap1 signaling pathway
100431483 (RAC2)
04310 Wnt signaling pathway
100431483 (RAC2)
04370 VEGF signaling pathway
100431483 (RAC2)
04071 Sphingolipid signaling pathway
100431483 (RAC2)
04024 cAMP signaling pathway
100431483 (RAC2)
09140 Cellular Processes
09144 Cellular community - eukaryotes
04510 Focal adhesion
100431483 (RAC2)
04520 Adherens junction
100431483 (RAC2)
09142 Cell motility
04810 Regulation of actin cytoskeleton
100431483 (RAC2)
09150 Organismal Systems
09151 Immune system
04613 Neutrophil extracellular trap formation
100431483 (RAC2)
04650 Natural killer cell mediated cytotoxicity
100431483 (RAC2)
04662 B cell receptor signaling pathway
100431483 (RAC2)
04664 Fc epsilon RI signaling pathway
100431483 (RAC2)
04666 Fc gamma R-mediated phagocytosis
100431483 (RAC2)
04670 Leukocyte transendothelial migration
100431483 (RAC2)
04062 Chemokine signaling pathway
100431483 (RAC2)
09158 Development and regeneration
04360 Axon guidance
100431483 (RAC2)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
100431483 (RAC2)
05231 Choline metabolism in cancer
100431483 (RAC2)
09162 Cancer: specific types
05210 Colorectal cancer
100431483 (RAC2)
05212 Pancreatic cancer
100431483 (RAC2)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
100431483 (RAC2)
05163 Human cytomegalovirus infection
100431483 (RAC2)
09171 Infectious disease: bacterial
05135 Yersinia infection
100431483 (RAC2)
09164 Neurodegenerative disease
05020 Prion disease
100431483 (RAC2)
09166 Cardiovascular disease
05418 Fluid shear stress and atherosclerosis
100431483 (RAC2)
05415 Diabetic cardiomyopathy
100431483 (RAC2)
05416 Viral myocarditis
100431483 (RAC2)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04031 GTP-binding proteins [BR:pon04031]
100431483 (RAC2)
GTP-binding proteins [BR:pon04031]
Small (monomeric) G-proteins
Rho Family
Rac/Cdc42 [OT]
100431483 (RAC2)
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| Position |
23:complement(43749580..43769534)
|
|---|
| AA seq |
192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRTCSLL |
|---|
| NT seq |
579 nt +upstreamnt +downstreamnt
atgcaggccatcaaatgtgtggtggtgggagatggggccgtgggcaagacctgccttctc
atcagctacaccaccaatgcctttcccggagagtacatccccaccgtgtttgacaactat
tcagccaacgtgatggtggacagcaagccagtgaacctggggctgtgggacactgctggg
caggaggactacgaccgtctccggccgctctcctacccacagacggatgtcttcctcatc
tgcttctccctcgtcagcccagcctcttatgagaacgtccgcgccaagtggttcccggaa
gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggacctgcgg
gacgacaaggacaccatcgagaaactgaaggagaagaagctggctcccatcacctacccg
cagggcctggcactggccaaggagattgactcggtgaaatacctggagtgctcagccctc
acccagagaggcctgaaaactgtgttcgacgaggccatccgggccgtgctgtgccctcag
cccacgcggcagcagaagcgcacctgcagcctcctctag |
|---|
