KEGG   Pongo abelii (Sumatran orangutan): 100431824
Entry
100431824         CDS       T01416                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04140  Autophagy - animal
pon04148  Efferocytosis
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04350  TGF-beta signaling pathway
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04371  Apelin signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04520  Adherens junction
pon04540  Gap junction
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04668  TNF signaling pathway
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04722  Neurotrophin signaling pathway
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04730  Long-term depression
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04912  GnRH signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04926  Relaxin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04929  GnRH secretion
pon04930  Type II diabetes mellitus
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04960  Aldosterone-regulated sodium reabsorption
pon05010  Alzheimer disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05034  Alcoholism
pon05132  Salmonella infection
pon05133  Pertussis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05207  Chemical carcinogenesis - receptor activation
pon05208  Chemical carcinogenesis - reactive oxygen species
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05216  Thyroid cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100431824 (MAPK3)
   04012 ErbB signaling pathway
    100431824 (MAPK3)
   04014 Ras signaling pathway
    100431824 (MAPK3)
   04015 Rap1 signaling pathway
    100431824 (MAPK3)
   04350 TGF-beta signaling pathway
    100431824 (MAPK3)
   04370 VEGF signaling pathway
    100431824 (MAPK3)
   04371 Apelin signaling pathway
    100431824 (MAPK3)
   04668 TNF signaling pathway
    100431824 (MAPK3)
   04066 HIF-1 signaling pathway
    100431824 (MAPK3)
   04068 FoxO signaling pathway
    100431824 (MAPK3)
   04072 Phospholipase D signaling pathway
    100431824 (MAPK3)
   04071 Sphingolipid signaling pathway
    100431824 (MAPK3)
   04024 cAMP signaling pathway
    100431824 (MAPK3)
   04022 cGMP-PKG signaling pathway
    100431824 (MAPK3)
   04151 PI3K-Akt signaling pathway
    100431824 (MAPK3)
   04150 mTOR signaling pathway
    100431824 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100431824 (MAPK3)
   04148 Efferocytosis
    100431824 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100431824 (MAPK3)
   04210 Apoptosis
    100431824 (MAPK3)
   04218 Cellular senescence
    100431824 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100431824 (MAPK3)
   04520 Adherens junction
    100431824 (MAPK3)
   04540 Gap junction
    100431824 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100431824 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100431824 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100431824 (MAPK3)
   04613 Neutrophil extracellular trap formation
    100431824 (MAPK3)
   04620 Toll-like receptor signaling pathway
    100431824 (MAPK3)
   04621 NOD-like receptor signaling pathway
    100431824 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    100431824 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    100431824 (MAPK3)
   04660 T cell receptor signaling pathway
    100431824 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    100431824 (MAPK3)
   04659 Th17 cell differentiation
    100431824 (MAPK3)
   04657 IL-17 signaling pathway
    100431824 (MAPK3)
   04662 B cell receptor signaling pathway
    100431824 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    100431824 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    100431824 (MAPK3)
   04062 Chemokine signaling pathway
    100431824 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100431824 (MAPK3)
   04929 GnRH secretion
    100431824 (MAPK3)
   04912 GnRH signaling pathway
    100431824 (MAPK3)
   04915 Estrogen signaling pathway
    100431824 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    100431824 (MAPK3)
   04917 Prolactin signaling pathway
    100431824 (MAPK3)
   04921 Oxytocin signaling pathway
    100431824 (MAPK3)
   04926 Relaxin signaling pathway
    100431824 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    100431824 (MAPK3)
   04919 Thyroid hormone signaling pathway
    100431824 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    100431824 (MAPK3)
   04916 Melanogenesis
    100431824 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100431824 (MAPK3)
   04270 Vascular smooth muscle contraction
    100431824 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100431824 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100431824 (MAPK3)
   04725 Cholinergic synapse
    100431824 (MAPK3)
   04726 Serotonergic synapse
    100431824 (MAPK3)
   04720 Long-term potentiation
    100431824 (MAPK3)
   04730 Long-term depression
    100431824 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    100431824 (MAPK3)
   04722 Neurotrophin signaling pathway
    100431824 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    100431824 (MAPK3)
   04380 Osteoclast differentiation
    100431824 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100431824 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431824 (MAPK3)
   05206 MicroRNAs in cancer
    100431824 (MAPK3)
   05205 Proteoglycans in cancer
    100431824 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    100431824 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    100431824 (MAPK3)
   05203 Viral carcinogenesis
    100431824 (MAPK3)
   05230 Central carbon metabolism in cancer
    100431824 (MAPK3)
   05231 Choline metabolism in cancer
    100431824 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100431824 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100431824 (MAPK3)
   05212 Pancreatic cancer
    100431824 (MAPK3)
   05225 Hepatocellular carcinoma
    100431824 (MAPK3)
   05226 Gastric cancer
    100431824 (MAPK3)
   05214 Glioma
    100431824 (MAPK3)
   05216 Thyroid cancer
    100431824 (MAPK3)
   05221 Acute myeloid leukemia
    100431824 (MAPK3)
   05220 Chronic myeloid leukemia
    100431824 (MAPK3)
   05218 Melanoma
    100431824 (MAPK3)
   05211 Renal cell carcinoma
    100431824 (MAPK3)
   05219 Bladder cancer
    100431824 (MAPK3)
   05215 Prostate cancer
    100431824 (MAPK3)
   05213 Endometrial cancer
    100431824 (MAPK3)
   05224 Breast cancer
    100431824 (MAPK3)
   05223 Non-small cell lung cancer
    100431824 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100431824 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    100431824 (MAPK3)
   05161 Hepatitis B
    100431824 (MAPK3)
   05160 Hepatitis C
    100431824 (MAPK3)
   05171 Coronavirus disease - COVID-19
    100431824 (MAPK3)
   05164 Influenza A
    100431824 (MAPK3)
   05163 Human cytomegalovirus infection
    100431824 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100431824 (MAPK3)
   05165 Human papillomavirus infection
    100431824 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100431824 (MAPK3)
   05135 Yersinia infection
    100431824 (MAPK3)
   05133 Pertussis
    100431824 (MAPK3)
   05152 Tuberculosis
    100431824 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100431824 (MAPK3)
   05140 Leishmaniasis
    100431824 (MAPK3)
   05142 Chagas disease
    100431824 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100431824 (MAPK3)
   05020 Prion disease
    100431824 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    100431824 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    100431824 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100431824 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100431824 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100431824 (MAPK3)
   04934 Cushing syndrome
    100431824 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100431824 (MAPK3)
   01524 Platinum drug resistance
    100431824 (MAPK3)
   01522 Endocrine resistance
    100431824 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100431824 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100431824 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100431824 (MAPK3)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100431824 (MAPK3)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100431824 (MAPK3)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100431824 (MAPK3)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100431824 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 100431824
NCBI-ProteinID: XP_002826343
Ensembl: ENSPPYG00000007239
LinkDB
Position
18:32023549..32032660
AA seq 381 aa
MAAAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSS
AYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDV
YIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTC
DLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEM
LSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPK
SDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKE
RLKELIFQETARFQPGVLEAP
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggctcaggggggcgggggcggggagccccgtagaaccgag
ggggtcggcccgggggtcccgggggaggtggagatggtgaaggggcagccgttcgacgtg
ggcccgcgctacacgcagttgcagtacatcggcgagggcgcgtacggcatggtcagctcg
gcctatgaccacgtgcgcaagactcgcgtggccatcaagaagatcagccccttcgagcat
cagacctactgccagcgcacgctccgggagatccagatcctgctgcgcttccgccatgag
aatgtcatcggcatccgagacattctgcgggcgtccaccctggaagccatgagggatgtc
tacattgtgcaggacctgatggagactgacctgtacaagttgctgaaaagccagcagctg
agcaatgaccatatctgctacttcctctaccagatcctgcggggcctcaaatacatccac
tccgccaacgtgctccaccgagatctaaagccctccaacctgctcatcaacaccacctgc
gaccttaagatttgcgatttcggcctggcccggattgccgatcctgagcatgaccacacc
ggcttcctgacggagtatgtggctacgcgctggtaccgggccccagagatcatgctgaac
tccaagggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatg
ctctctaaccggcccatcttccccggcaagcactacctggatcagctcaaccacattctg
ggcatcctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccga
aactacctacagtctctgccctccaagaccaaggtggcttgggccaagctttttcccaag
tcagactccaaagcccttgacctgctggaccggatgttaacctttaaccccaataaacgg
atcacagtggaggaagcgctggctcacccctacctggagcagtactatgacccgacggat
gagccagtggccgaggagcccttcaccttcgccatggagctggacgacctacctaaggag
cggctgaaggagctcatcttccaggagacagcacgcttccagcccggagtgctggaggcc
ccctag

DBGET integrated database retrieval system