Pongo abelii (Sumatran orangutan): 100432760 Help Entry 100432760         CDS       T01416                                  Name (RefSeq) ubiquitin-like isoform X1   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon03010   Ribosome pon04120   Ubiquitin mediated proteolysis pon04137   Mitophagy - animal pon04140   Autophagy - animal pon05012   Parkinson disease pon05022   Pathways of neurodegeneration - multiple diseases pon05167   Kaposi sarcoma-associated herpesvirus infection pon05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:pon00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     100432760   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100432760  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100432760    04137 Mitophagy - animal     100432760  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100432760    05167 Kaposi sarcoma-associated herpesvirus infection     100432760   09164 Neurodegenerative disease    05012 Parkinson disease     100432760    05022 Pathways of neurodegeneration - multiple diseases     100432760  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:pon03011]     100432760    04121 Ubiquitin system [BR:pon04121]     100432760 Ribosome [BR:pon03011]  Ribosomal proteins   Eukaryotes    Large subunit     100432760   Archaea     100432760 Ubiquitin system [BR:pon04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    100432760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ribosomal_L40e Rad60-SLD TBK1_ULD Dsc3_N Rad60-SLD_2 Ubiquitin_2 Motif Other DBs NCBI-GeneID:  100432760 NCBI-ProteinID:  XP_054415343 LinkDB All DBs Position 6:59500609..59500950 Genome browser AA seq 113 aa AA seqDB search MQIFVKTLTGKTIILEVEPSDTTENVKAKIQDKEGIPLDQQRLIFAGKQLEDDCTLSDCN IQKESILHLGLHLRGGIIEPSLCQLAQKYNCDKMICCKCCARLDPRAVKCCKK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagaccctcacaggcaagaccatcatcctcgaggtcgagcccagt gacaccactgagaatgtcaaggccaaaattcaagacaaggagggcattccacttgaccag caacgtctgatatttgcgggcaaacagctggaggatgactgcactctctcagactgcaac atccagaaagagtccatcctgcacctggggctgcacctgcgaggtggcattattgagcct tccctctgccagcttgcccagaaatacaactgcgacaagatgatctgctgcaagtgctgt gctcgcctggacccccgtgctgtcaaatgctgcaagaagtga

DBGET integrated database retrieval system