Pongo abelii (Sumatran orangutan): 100432903 Help Entry 100432903         CDS       T01416                                  Name (RefSeq) metallothionein-1E   KO K14739   metallothionein 1/2 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04978   Mineral absorption Brite KEGG Orthology (KO) [BR:pon00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     100432903  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pon03019]     100432903    03029 Mitochondrial biogenesis [BR:pon03029]     100432903 Messenger RNA biogenesis [BR:pon03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100432903 Mitochondrial biogenesis [BR:pon03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     100432903 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  100432903 NCBI-ProteinID:  XP_024088921 Ensembl:  ENSPPYG00000035562 LinkDB All DBs Position 18:55911113..55912430 Genome browser AA seq 61 aa AA seqDB search MDPNCSCTTGGSCTCACSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGSSEKCRCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcccaactgctcctgcaccacagggggctcctgcacctgtgcttgttcctgcaag tgcaaagagtgcaaatgcacctcctgcaagaaaagctgctgctcctgctgccctgtgggc tgtgccaagtgtgcccagggctgtgtctgcaaaggctcatcagagaagtgccgctgctgt gcctga

DBGET integrated database retrieval system