Pongo abelii (Sumatran orangutan): 100432906 Help Entry 100432906         CDS       T01416                                  Symbol IFNA2 Name (RefSeq) interferon alpha-2   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon04936   Alcoholic liver disease pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease pon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100432906 (IFNA2)    04151 PI3K-Akt signaling pathway     100432906 (IFNA2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100432906 (IFNA2)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100432906 (IFNA2)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100432906 (IFNA2)    04621 NOD-like receptor signaling pathway     100432906 (IFNA2)    04622 RIG-I-like receptor signaling pathway     100432906 (IFNA2)    04623 Cytosolic DNA-sensing pathway     100432906 (IFNA2)    04650 Natural killer cell mediated cytotoxicity     100432906 (IFNA2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100432906 (IFNA2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100432906 (IFNA2)    05161 Hepatitis B     100432906 (IFNA2)    05160 Hepatitis C     100432906 (IFNA2)    05171 Coronavirus disease - COVID-19     100432906 (IFNA2)    05164 Influenza A     100432906 (IFNA2)    05162 Measles     100432906 (IFNA2)    05168 Herpes simplex virus 1 infection     100432906 (IFNA2)    05163 Human cytomegalovirus infection     100432906 (IFNA2)    05167 Kaposi sarcoma-associated herpesvirus infection     100432906 (IFNA2)    05169 Epstein-Barr virus infection     100432906 (IFNA2)    05165 Human papillomavirus infection     100432906 (IFNA2)   09171 Infectious disease: bacterial    05152 Tuberculosis     100432906 (IFNA2)   09163 Immune disease    05320 Autoimmune thyroid disease     100432906 (IFNA2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100432906 (IFNA2)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100432906 (IFNA2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100432906 (IFNA2) Cytokines and neuropeptides [BR:pon04052]  Cytokines   Interferons    100432906 (IFNA2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon iSTAND DUF1340 Motif Other DBs NCBI-GeneID:  100432906 NCBI-ProteinID:  XP_002819788 UniProt:  H2PS17 LinkDB All DBs Position 13:36744113..36745259 Genome browser AA seq 188 aa AA seqDB search MALTFALLVTLLVLSCKSSCSLGCDLPQTHSLGNRRTLMLLAQMRRLSLFSCLKDRHDFG FPQEEFGNQFQKAQTIPVLHEMIQQIFNLFSTKDSCAAWDETLLDKFYTELYQQLNDLED CVMQEVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVREEIMRSFSLSTNL QESLRSKE NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atggccttgacctttgctttactggtgaccctcctggtgctcagctgcaagtcaagctgc tctctgggctgtgatctgcctcaaacccacagcctgggtaacaggaggaccttgatgctc ctggcacaaatgaggagactctctcttttctcctgcttgaaggacagacatgactttgga tttccccaggaggagtttggcaaccagttccaaaaggctcaaaccatccctgtcctccat gagatgatccagcagatcttcaatctcttcagcacaaaggactcatgtgctgcttgggat gagaccctcctagacaaattctacactgaactctaccagcagctgaatgacctggaagac tgtgtgatgcaggaggtgggggtgacagagactcccctgatgaaggaggactccattctg gctgtgaggaaatacttccaaagaatcactctctatctgaaagagaagaaatacagccct tgtgcctgggaggttgtcagagaagaaatcatgagatctttttctttgtcaacaaacttg caagaaagtttaagaagtaaggaatga

DBGET integrated database retrieval system