Pongo abelii (Sumatran orangutan): 100433071 Help Entry 100433071         CDS       T01416                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04613   Neutrophil extracellular trap formation pon05034   Alcoholism pon05202   Transcriptional misregulation in cancer pon05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pon00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100433071  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100433071   09163 Immune disease    05322 Systemic lupus erythematosus     100433071   09165 Substance dependence    05034 Alcoholism     100433071  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pon03036]     100433071   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pon04147]     100433071 Chromosome and associated proteins [BR:pon03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100433071 Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100433071 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  100433071 NCBI-ProteinID:  XP_002809433 Ensembl:  ENSPPYG00000000168 UniProt:  H2NUQ9 LinkDB All DBs Position 1:complement(23541998..23551365) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcacccaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggactttaaa acagatctgcgcttccagagcgcagctatcggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system