Pongo abelii (Sumatran orangutan): 100434269 Help Entry 100434269         CDS       T01416                                  Name (RefSeq) histone H2A type 1-J   KO K11251   histone H2A Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon03082   ATP-dependent chromatin remodeling pon04217   Necroptosis pon04613   Neutrophil extracellular trap formation pon05034   Alcoholism pon05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pon00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100434269  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100434269  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100434269  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     100434269   09165 Substance dependence    05034 Alcoholism     100434269  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pon03036]     100434269   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pon04147]     100434269 Chromosome and associated proteins [BR:pon03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100434269 Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100434269 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  100434269 NCBI-ProteinID:  XP_002816622 Ensembl:  ENSPPYG00000034993 LinkDB All DBs Position 5:complement(27708003..27708591) Genome browser AA seq 147 aa AA seqDB search MFFYFHLSSSGLYRYRPFAMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYA ERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKV TIAQGGVLPNIQAVLLPKKTESHHKTK NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgtttttctactttcatctcagttcttctggactgtatagatacaggccttttgccatg tctgggcgtggtaagcagggaggcaaagctcgcgccaaggccaagacccgctcatctcgg gccgggcttcagtttcccgtaggccgagtgcaccgcctgctccgcaaaggcaactatgcc gagcgggtcggggctggagcgccggtgtacttggcggcggtgctggagtacctgaccgcc gagatcctggagctggctggcaacgcggcccgcgacaacaagaagactcgcatcatcccg cgtcacctccagctggccatccgcaacgacgaggagctcaacaagcttctgggcaaagtc accatcgcacagggtggcgtcctgcccaacatccaggccgtgctgctgccaaagaaaact gagagccaccacaagactaagtaa

DBGET integrated database retrieval system