Pongo abelii (Sumatran orangutan): 100435461 Help Entry 100435461         CDS       T01416                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04061   Viral protein interaction with cytokine and cytokine receptor pon04062   Chemokine signaling pathway pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04668   TNF signaling pathway pon05020   Prion disease pon05142   Chagas disease pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05168   Herpes simplex virus 1 infection pon05323   Rheumatoid arthritis pon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     100435461 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100435461 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     100435461 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100435461 (CCL5)    04621 NOD-like receptor signaling pathway     100435461 (CCL5)    04623 Cytosolic DNA-sensing pathway     100435461 (CCL5)    04062 Chemokine signaling pathway     100435461 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     100435461 (CCL5)    05168 Herpes simplex virus 1 infection     100435461 (CCL5)    05163 Human cytomegalovirus infection     100435461 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     100435461 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     100435461 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     100435461 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100435461 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100435461 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:pon00536]     100435461 (CCL5) Cytokines and neuropeptides [BR:pon04052]  Cytokines   Chemokines    100435461 (CCL5) Glycosaminoglycan binding proteins [BR:pon00536]  Heparan sulfate / Heparin   Chemokines    100435461 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 MF_alpha_N Motif Other DBs NCBI-GeneID:  100435461 NCBI-ProteinID:  XP_002827318 Ensembl:  ENSPPYG00000031268 UniProt:  A0A6D2WNS6 LinkDB All DBs Position 19:complement(49887979..49896553) Genome browser AA seq 91 aa AA seqDB search MKVSAAALAVILIATALCAPASASPYASDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP AVVFVTRKNRQVCANPEKKWVREYINSLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcggcggccctcgctgtcatcctcattgctaccgccctctgcgctcct gcatctgcctccccatatgcctcggataccacaccctgctgctttgcctacattgcccgc ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca gcagtcgtctttgtcacccgaaagaaccgccaagtgtgtgccaacccagagaagaaatgg gttcgggagtacatcaactctttggagatgagctag

DBGET integrated database retrieval system