Pongo abelii (Sumatran orangutan): 100436349 Help Entry 100436349         CDS       T01416                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04022   cGMP-PKG signaling pathway pon04270   Vascular smooth muscle contraction pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     100436349 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     100436349 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100436349 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100436349 (NPPC) Cytokines and neuropeptides [BR:pon04052]  Neuropeptides   Neuropeptides (Unclassified)    100436349 (NPPC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  100436349 NCBI-ProteinID:  XP_002813031 Ensembl:  ENSPPYG00000013273 UniProt:  A0A6D2WAP2 LinkDB All DBs Position 2B:complement(119189412..119193709) Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKAPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcatctctcccagctgctggcctgtgccctgctgctcacgctgctctcactccggccc tccgaagccaagcccggggcgccgccgaaggtcccgcgaaccccgccgggagaggagctg gccgagccgcaggctgcgggcggcggtcagaagaagggcgacaaggctcccgggggcggg ggcgccaacctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag tcgcgggcagcgtgggcccgccttctgcaagagcaccccaacgcgcgcaaatacaaagga gccaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccgaatcggctcc atgagcggcctgggatgttag

DBGET integrated database retrieval system