Pongo abelii (Sumatran orangutan): 100436811 Help Entry 100436811         CDS       T01416                                  Symbol CALML3 Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04014   Ras signaling pathway pon04015   Rap1 signaling pathway pon04020   Calcium signaling pathway pon04022   cGMP-PKG signaling pathway pon04024   cAMP signaling pathway pon04070   Phosphatidylinositol signaling system pon04114   Oocyte meiosis pon04218   Cellular senescence pon04261   Adrenergic signaling in cardiomyocytes pon04270   Vascular smooth muscle contraction pon04371   Apelin signaling pathway pon04625   C-type lectin receptor signaling pathway pon04713   Circadian entrainment pon04720   Long-term potentiation pon04722   Neurotrophin signaling pathway pon04728   Dopaminergic synapse pon04740   Olfactory transduction pon04744   Phototransduction pon04750   Inflammatory mediator regulation of TRP channels pon04910   Insulin signaling pathway pon04912   GnRH signaling pathway pon04915   Estrogen signaling pathway pon04916   Melanogenesis pon04921   Oxytocin signaling pathway pon04922   Glucagon signaling pathway pon04924   Renin secretion pon04925   Aldosterone synthesis and secretion pon04970   Salivary secretion pon04971   Gastric acid secretion pon05010   Alzheimer disease pon05012   Parkinson disease pon05022   Pathways of neurodegeneration - multiple diseases pon05031   Amphetamine addiction pon05034   Alcoholism pon05133   Pertussis pon05152   Tuberculosis pon05163   Human cytomegalovirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05170   Human immunodeficiency virus 1 infection pon05200   Pathways in cancer pon05214   Glioma pon05417   Lipid and atherosclerosis pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100436811 (CALML3)    04015 Rap1 signaling pathway     100436811 (CALML3)    04371 Apelin signaling pathway     100436811 (CALML3)    04020 Calcium signaling pathway     100436811 (CALML3)    04070 Phosphatidylinositol signaling system     100436811 (CALML3)    04024 cAMP signaling pathway     100436811 (CALML3)    04022 cGMP-PKG signaling pathway     100436811 (CALML3)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100436811 (CALML3)    04218 Cellular senescence     100436811 (CALML3)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100436811 (CALML3)   09152 Endocrine system    04910 Insulin signaling pathway     100436811 (CALML3)    04922 Glucagon signaling pathway     100436811 (CALML3)    04912 GnRH signaling pathway     100436811 (CALML3)    04915 Estrogen signaling pathway     100436811 (CALML3)    04921 Oxytocin signaling pathway     100436811 (CALML3)    04916 Melanogenesis     100436811 (CALML3)    04924 Renin secretion     100436811 (CALML3)    04925 Aldosterone synthesis and secretion     100436811 (CALML3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100436811 (CALML3)    04270 Vascular smooth muscle contraction     100436811 (CALML3)   09154 Digestive system    04970 Salivary secretion     100436811 (CALML3)    04971 Gastric acid secretion     100436811 (CALML3)   09156 Nervous system    04728 Dopaminergic synapse     100436811 (CALML3)    04720 Long-term potentiation     100436811 (CALML3)    04722 Neurotrophin signaling pathway     100436811 (CALML3)   09157 Sensory system    04744 Phototransduction     100436811 (CALML3)    04740 Olfactory transduction     100436811 (CALML3)    04750 Inflammatory mediator regulation of TRP channels     100436811 (CALML3)   09159 Environmental adaptation    04713 Circadian entrainment     100436811 (CALML3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100436811 (CALML3)   09162 Cancer: specific types    05214 Glioma     100436811 (CALML3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100436811 (CALML3)    05163 Human cytomegalovirus infection     100436811 (CALML3)    05167 Kaposi sarcoma-associated herpesvirus infection     100436811 (CALML3)   09171 Infectious disease: bacterial    05133 Pertussis     100436811 (CALML3)    05152 Tuberculosis     100436811 (CALML3)   09164 Neurodegenerative disease    05010 Alzheimer disease     100436811 (CALML3)    05012 Parkinson disease     100436811 (CALML3)    05022 Pathways of neurodegeneration - multiple diseases     100436811 (CALML3)   09165 Substance dependence    05031 Amphetamine addiction     100436811 (CALML3)    05034 Alcoholism     100436811 (CALML3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100436811 (CALML3)    05418 Fluid shear stress and atherosclerosis     100436811 (CALML3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pon01009]     100436811 (CALML3)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100436811 (CALML3)    03036 Chromosome and associated proteins [BR:pon03036]     100436811 (CALML3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pon04147]     100436811 (CALML3) Protein phosphatases and associated proteins [BR:pon01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100436811 (CALML3) Membrane trafficking [BR:pon04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100436811 (CALML3) Chromosome and associated proteins [BR:pon03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100436811 (CALML3) Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100436811 (CALML3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg UPF0154 Dockerin_1 EFhand_Ca_insen Caleosin DUF5580_M EF-hand_11 FCaBP_EF-hand SurA_N_3 DUF1103 SurA_N_2 DUF2267 Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  100436811 NCBI-ProteinID:  XP_009243366 Ensembl:  ENSPPYG00000002059 LinkDB All DBs Position 8:5609364..5611160 Genome browser AA seq 149 aa AA seqDB search MADQLTEEQITEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPSEAELRDMVSEIDRDG NGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGERLSDE EVDEMIRAADTDGDGQVNYEEFVRVLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagctgactgaggagcagatcacggaattcaaggaggccttctccctgttt gacaaggatggggacggctgcatcaccacccgcgagctgggcacggtcatgcggtccctg ggccagaacccctcggaggccgagctgcgggacatggtgagtgagatcgaccgggacggc aacggcaccgtggacttccccgagttcctgggcatgatggccaggaagatgaaggacacg gacaacgaggaggagatccgcgaggccttccgcgtgttcgacaaggacggcaacggcttc gtcagcgccgccgagctgcgacacgtcatgacccggctgggggagaggctgagcgacgag gaggtggacgagatgatccgggccgcggacacggacggagacggacaggtgaactacgag gagttcgtccgtgtgctggtgtccaagtga

DBGET integrated database retrieval system