KEGG   Pongo abelii (Sumatran orangutan): 100437604
Entry
100437604         CDS       T01416                                 
Symbol
RAB6C
Name
(RefSeq) LOW QUALITY PROTEIN: ras-related protein Rab-6C
  KO
K07895  Ras-related protein Rab-6C
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100437604 (RAB6C)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    100437604 (RAB6C)
Membrane trafficking [BR:pon04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    100437604 (RAB6C)
GTP-binding proteins [BR:pon04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    100437604 (RAB6C)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB
Other DBs
NCBI-GeneID: 100437604
NCBI-ProteinID: XP_009235878
LinkDB
Position
2B:complement(1213008..1213772)
AA seq 254 aa
MSTGGDXGNPLRKFKLEFLGEQSVAKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDG
TIRLRLWDTAGQERLRSLIPSYSRDSAAAVAVYDITNVNSFQQTTKWIDDVRTERGSDVI
ITLVGNKTDLADKRQVSIEDGERKAKELNVMFIETRAKAGYNVKQLFRPVAAVLPGMEST
QDRSREDMSDIKLEKPQEQPVSEGGCSCYSPMSSSTLPQKPPYSFIDCSVNIGLNLLPSI
ITFCNSSLLPVSWR
NT seq 765 nt   +upstreamnt  +downstreamnt
atgtccacgggcggagactaggggaatccgctgaggaaattcaagctggagttcctgggg
gagcaaagcgttgcaaagacgtctttgatcaccagattcatgtatgacagttttgacaac
acctatcaggcaacaattggcattgactttttatcaaaaactatgtacttggaggatgga
acaatcaggcttcggctgtgggatactgcgggtcaggaacgtctccgtagccttattccc
agttacagccgtgattctgctgcagctgtagcagtttacgatatcacaaatgttaactcc
ttccagcaaactacaaagtggattgatgatgtcagaacagaaagaggaagtgatgttatc
atcacgctagtaggaaataaaacagatcttgctgacaagaggcaagtgtcaattgaggac
ggagagaggaaagccaaagagctgaatgttatgtttattgaaactagggcaaaagctgga
tacaatgtaaagcagctctttcgacctgtagcagcagttttgccgggaatggaaagcaca
caggacagaagcagagaagacatgagtgacataaaactggaaaagcctcaggagcaacca
gtcagcgaaggaggctgttcctgctactctcccatgtcatcttccacccttcctcagaag
cccccttactctttcattgactgcagtgtgaatattggcttgaaccttctcccttcaata
ataacgttttgcaattcgtcattgctgcctgtctcgtggagatga

DBGET integrated database retrieval system