Pongo abelii (Sumatran orangutan): 100437992 Help Entry 100437992         CDS       T01416                                  Symbol CXCL14 Name (RefSeq) C-X-C motif chemokine 14   KO K10033   C-X-C motif chemokine 14 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04061   Viral protein interaction with cytokine and cytokine receptor pon04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100437992 (CXCL14)    04061 Viral protein interaction with cytokine and cytokine receptor     100437992 (CXCL14)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     100437992 (CXCL14)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100437992 (CXCL14) Cytokines and neuropeptides [BR:pon04052]  Cytokines   Chemokines    100437992 (CXCL14) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF6355 Motif Other DBs NCBI-GeneID:  100437992 NCBI-ProteinID:  XP_002815949 Ensembl:  ENSPPYG00000015802 UniProt:  Q5RCF4 LinkDB All DBs Position 4:complement(143945182..143953546) Genome browser AA seq 111 aa AA seqDB search MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKY PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgtccctgctcccacgccgcgcccctccagtcagcatgaggctcctggcggccgcgctg ctcctgctgctgctggcgctgtacaccgcgcgtgtggacgggtccaaatgcaagtgttcc cggaagggacccaagatccgctacagcgacgtgaagaagctggaaatgaagccaaagtac ccgcactgcgaggagaagatggttatcatcaccaccaagagcgtgtccaggtaccgaggt caggagcactgcctgcaccccaagctgcagagcaccaagcgcttcatcaagtggtacaac gcctggaacgagaagcgcagggtctacgaagaatag

DBGET integrated database retrieval system