KEGG   Pongo abelii (Sumatran orangutan): 100441942
Entry
100441942         CDS       T01416                                 
Name
(RefSeq) ras-related protein Rab-6C
  KO
K07895  Ras-related protein Rab-6C
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100441942
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    100441942
Membrane trafficking [BR:pon04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    100441942
GTP-binding proteins [BR:pon04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    100441942
SSDB
Motif
Pfam: Ras Roc Arf SRPRB FeoB_N
Other DBs
NCBI-GeneID: 100441942
NCBI-ProteinID: XP_003780268
UniProt: A0A2J8S8K0
LinkDB
Position
21:469877..470701
AA seq 254 aa
MSAGGDFGNPLTKFKLVFLGEQSVAKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDG
TIRLPLWDTAGQERLRSLIPSYIRDSAAAVVVYGITNVNSFQQTTKWIDDVRTERGSDVI
ITLVGNKTDLADKRQVSIEEGERKAKQLNVMFIETSAKAGYNVKQLFRRVAAVLPGMEST
QDGSREDMSDIKLEKPQEQPVSERGCSCYSPMSSSTLPQKPPYSFIDCSVNIGLNLFPSV
ITFCNSSLLPVSWR
NT seq 765 nt   +upstreamnt  +downstreamnt
atgtccgcgggcggagacttcgggaatccgctgacgaaattcaagctggtgttcctgggg
gagcaaagcgttgcaaagacatctttgatcaccagattcatgtatgacagttttgacaac
acctatcaggcaacgattggcattgactttttatcaaaaactatgtacttggaggatgga
acaatcaggcttccgctgtgggatactgcgggtcaggaacgtctccgtagcctcattccc
agttacatccgtgattctgctgcagctgtagtagtttacggtatcacaaatgttaactca
ttccagcaaactacaaagtggattgatgatgtcagaacagaaagaggaagtgatgttatc
atcacgctagtaggaaataaaacagatcttgctgacaagaggcaagtgtcaattgaggag
ggagagaggaaagccaaacagctgaatgttatgtttattgaaactagtgcaaaagctgga
tacaatgtaaagcagctctttcgacgtgtagcagcagttttgccgggaatggaaagcaca
caggacggaagcagagaagacatgagtgacataaaactggaaaagcctcaggagcaacca
gtcagcgaaagaggctgttcctgctactctcccatgtcatcttcaacccttcctcagaag
cccccttactctttcattgactgcagtgtgaatattggcttgaaccttttcccttcagta
ataacgttttgcaattcatcattgctgcctgtctcgtggagatga

DBGET integrated database retrieval system