Pongo abelii (Sumatran orangutan): 100444807 Help Entry 100444807         CDS       T01416                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04620   Toll-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04625   C-type lectin receptor signaling pathway pon04630   JAK-STAT signaling pathway pon04658   Th1 and Th2 cell differentiation pon04936   Alcoholic liver disease pon04940   Type I diabetes mellitus pon05133   Pertussis pon05134   Legionellosis pon05140   Leishmaniasis pon05142   Chagas disease pon05143   African trypanosomiasis pon05144   Malaria pon05145   Toxoplasmosis pon05146   Amoebiasis pon05152   Tuberculosis pon05162   Measles pon05164   Influenza A pon05168   Herpes simplex virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05321   Inflammatory bowel disease pon05330   Allograft rejection pon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100444807 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100444807 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100444807 (IL12A)    04622 RIG-I-like receptor signaling pathway     100444807 (IL12A)    04625 C-type lectin receptor signaling pathway     100444807 (IL12A)    04658 Th1 and Th2 cell differentiation     100444807 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100444807 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100444807 (IL12A)    05164 Influenza A     100444807 (IL12A)    05162 Measles     100444807 (IL12A)    05168 Herpes simplex virus 1 infection     100444807 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     100444807 (IL12A)    05134 Legionellosis     100444807 (IL12A)    05152 Tuberculosis     100444807 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     100444807 (IL12A)    05144 Malaria     100444807 (IL12A)    05145 Toxoplasmosis     100444807 (IL12A)    05140 Leishmaniasis     100444807 (IL12A)    05142 Chagas disease     100444807 (IL12A)    05143 African trypanosomiasis     100444807 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     100444807 (IL12A)    05330 Allograft rejection     100444807 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100444807 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100444807 (IL12A)    04936 Alcoholic liver disease     100444807 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100444807 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:pon00536]     100444807 (IL12A) Cytokines and neuropeptides [BR:pon04052]  Cytokines   Interleukins    100444807 (IL12A) Glycosaminoglycan binding proteins [BR:pon00536]  Heparan sulfate / Heparin   Cytokines    100444807 (IL12A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  100444807 NCBI-ProteinID:  XP_002814285 Ensembl:  ENSPPYG00000014253 UniProt:  H2PBV7 LinkDB All DBs Position 2:169713684..169721019 Genome browser AA seq 253 aa AA seqDB search MWPPGSASQPPPSPAAATGLHPAARPVSLQCRLSMCPARSLLLVATLVLLDHLSLARNLP VATPGPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDQTSTVEACL PLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLL MDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRA VTIDRVMNYLNAS NT seq 762 nt NT seq  +upstreamnt  +downstreamnt atgtggccccctgggtcagcctcccagccaccgccctcacctgccgcggccacaggtctg catccagcggctcgcccagtgtccctgcagtgccggctcagcatgtgtccagcgcgcagc ctcctccttgtggctaccctggtcctcctggaccacctcagtttggccagaaacctccct gtggccaccccaggcccaggaatgttcccgtgccttcaccactcccaaaacctgctgagg gccgtcagcaacatgctccagaaggccagacaaactctagaattctacccttgcacttct gaagagattgatcatgaagatatcacaaaagatcaaaccagcacagtggaggcctgttta ccattggaattaaccaagaatgagagttgcctaaattccagagagacctctttcataact aatgggagttgcctggcctccagaaagacctcttttatgatggccctgtgccttagtagt atttatgaagacttgaagatgtaccaggtggagttcaagaccatgaatgcaaagcttctg atggatcctaagaggcagatctttctagatcaaaacatgctggcagttattgatgagctg atgcaggccctgaatttcaacagtgagactgtgccacaaaaatcctcccttgaagaaccg gatttttataaaactaaaatcaagctctgcatacttcttcatgctttcagaattcgggca gtgactattgatagagtgatgaactatctgaatgcttcctaa

DBGET integrated database retrieval system