Pongo abelii (Sumatran orangutan): 100447289 Help Entry 100447289         CDS       T01416                                  Symbol FGF21 Name (RefSeq) fibroblast growth factor 21   KO K22429   fibroblast growth factor 21 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04010   MAPK signaling pathway pon04014   Ras signaling pathway pon04015   Rap1 signaling pathway pon04020   Calcium signaling pathway pon04151   PI3K-Akt signaling pathway pon04714   Thermogenesis pon04810   Regulation of actin cytoskeleton pon05200   Pathways in cancer pon05218   Melanoma pon05224   Breast cancer pon05226   Gastric cancer Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100447289 (FGF21)    04014 Ras signaling pathway     100447289 (FGF21)    04015 Rap1 signaling pathway     100447289 (FGF21)    04020 Calcium signaling pathway     100447289 (FGF21)    04151 PI3K-Akt signaling pathway     100447289 (FGF21)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100447289 (FGF21)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     100447289 (FGF21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100447289 (FGF21)   09162 Cancer: specific types    05226 Gastric cancer     100447289 (FGF21)    05218 Melanoma     100447289 (FGF21)    05224 Breast cancer     100447289 (FGF21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100447289 (FGF21)    00536 Glycosaminoglycan binding proteins [BR:pon00536]     100447289 (FGF21) Cytokines and neuropeptides [BR:pon04052]  Cytokines   Growth factors (RTK binding)    100447289 (FGF21) Glycosaminoglycan binding proteins [BR:pon00536]  Heparan sulfate / Heparin   Growth factors/receptors    100447289 (FGF21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Lysis_col Motif Other DBs NCBI-GeneID:  100447289 NCBI-ProteinID:  XP_002829565 Ensembl:  ENSPPYG00000010214 UniProt:  A0A2J8U7P8 LinkDB All DBs Position 20:54953975..54956336 Genome browser AA seq 209 aa AA seqDB search MDSDETGFEHSGLWVPVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAH LEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGI LAPQPPDVGSSDPLSMVGPSQGRSPSYAS NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggactcggacgagaccgggttcgagcactcaggactgtgggttcctgtgctggctggt cttctgctgggagcctgccaggcacaccccatccctgactccagtcctctcctgcaattc gggggccaagtccggcagcggtacctctacacagatgatgcccagcagacagaagcccac ctggagatcagggaggatgggacggtggggggcgctgctgaccagagccccgaaagtctc ctgcagctgaaagccttgaagccgggagttattcaaatcttgggagtcaagacatccagg ttcctgtgccagaggccagatggggccctgtatggatcgctccactttgaccctgaggcc tgcagcttccgggagctgcttcttgaggacggatacaatgtttatcagtccgaggcccat ggcctcccgctgcatctgccgggaaacaagtccccacaccgggaccctgcaccccgagga ccagctcgcttcctgccactaccaggcctgccccccgcacccccagagccgcccggaatc ctggccccccagccccccgatgtgggctcctcggaccctctgagcatggtgggaccttcc cagggccgaagccccagctatgcttcctga

DBGET integrated database retrieval system