Pongo abelii (Sumatran orangutan): 100447563 Help Entry 100447563         CDS       T01416                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04613   Neutrophil extracellular trap formation pon05034   Alcoholism pon05202   Transcriptional misregulation in cancer pon05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pon00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100447563  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100447563   09163 Immune disease    05322 Systemic lupus erythematosus     100447563   09165 Substance dependence    05034 Alcoholism     100447563  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pon03036]     100447563   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pon04147]     100447563 Chromosome and associated proteins [BR:pon03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100447563 Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100447563 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  100447563 NCBI-ProteinID:  XP_009233498 Ensembl:  ENSPPYG00000033691 LinkDB All DBs Position X:<129397103..129397901 Genome browser AA seq 141 aa AA seqDB search GGLCTVARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKHHRYRPGTVALREIRRY QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHA KRVTIMPKDIQLACRIRGERA NT seq 426 nt NT seq  +upstreamnt  +downstreamnt ggaggtctctgtaccgtggctcgtacaaagcagaccgcccgcaaatcgaccggtggtaaa gcacccaggaagcaactggctacaaaagccgctcgcaagagtgcgccctctactggaggg gtgaagaaacatcatcgttacaggcctggtactgtggcgctccgtgaaattagacgttat cagaagtccactgaacttctgattcgcaaacttcccttccagcgtctggtgcgagaaatt gctcaggactttaaaacagatctgcgcttccagagcgcagctatcggtgctttgcaggag gcaagtgaggcctatctggtcggcctttttgaagacaccaacctgtgtgctatccatgcc aaacgtgtaacaattatgccaaaagacatccagctagcatgccgcatacgtggagaacgt gcttaa

DBGET integrated database retrieval system