Pongo abelii (Sumatran orangutan): 100448388 Help Entry 100448388         CDS       T01416                                  Symbol FGF22 Name (RefSeq) fibroblast growth factor 22   KO K04358   fibroblast growth factor Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04010   MAPK signaling pathway pon04014   Ras signaling pathway pon04015   Rap1 signaling pathway pon04020   Calcium signaling pathway pon04151   PI3K-Akt signaling pathway pon04810   Regulation of actin cytoskeleton pon05200   Pathways in cancer pon05207   Chemical carcinogenesis - receptor activation pon05218   Melanoma pon05224   Breast cancer pon05226   Gastric cancer Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100448388 (FGF22)    04014 Ras signaling pathway     100448388 (FGF22)    04015 Rap1 signaling pathway     100448388 (FGF22)    04020 Calcium signaling pathway     100448388 (FGF22)    04151 PI3K-Akt signaling pathway     100448388 (FGF22)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100448388 (FGF22)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100448388 (FGF22)    05207 Chemical carcinogenesis - receptor activation     100448388 (FGF22)   09162 Cancer: specific types    05226 Gastric cancer     100448388 (FGF22)    05218 Melanoma     100448388 (FGF22)    05224 Breast cancer     100448388 (FGF22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100448388 (FGF22)    00536 Glycosaminoglycan binding proteins [BR:pon00536]     100448388 (FGF22) Cytokines and neuropeptides [BR:pon04052]  Cytokines   Growth factors (RTK binding)    100448388 (FGF22) Glycosaminoglycan binding proteins [BR:pon00536]  Heparan sulfate / Heparin   Growth factors/receptors    100448388 (FGF22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin Motif Other DBs NCBI-GeneID:  100448388 NCBI-ProteinID:  XP_024093685 Ensembl:  ENSPPYG00000009283 LinkDB All DBs Position 20:388449..392881 Genome browser AA seq 170 aa AA seqDB search MRRRLWLGLAWLLLARAPDAAGTPSALRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGR VQGTRWRHGQDSILEIRSVRVGVVVIKAVSSGFYVAMNRQGRLYGSRLYTADCRFRERIE ENGHNTYASQRWRRHGQPMFLALDRQGGPRPGGRTRRYHLSAHFLPVLVS NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgcgccgccgcctgtggctgggcctggcctggctgctgctggcgcgggcgccggacgcc gcgggaaccccgagcgcgctgcggggaccgcgcagctacccgcacctggagggcgacgtg cgctggcggcgcctcttctcctccactcacttcttcctgcgcgtggatcccggcggccgc gtgcagggcacccgctggcgccacggccaggacagtatcctggagatccgctctgtacgc gtgggcgttgtggtcatcaaagcggtgtcctcaggcttctacgtggccatgaaccgccag ggccgcctctacgggtcgcgactctacactgcggactgcaggttccgggagcgcatcgaa gagaacggccacaacacctacgcctcacagcgctggcgccgccacggccagcccatgttc ctggcactggacaggcagggggggccccggccaggcggccggacgcggcggtaccacctg tccgcccacttcctgcccgtcctggtctcctga

DBGET integrated database retrieval system