Pongo abelii (Sumatran orangutan): 100451146 Help Entry 100451146         CDS       T01416                                  Name (RefSeq) claudin-6-like   KO K06087   claudin Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon03272   Virion - Hepatitis viruses pon04382   Cornified envelope formation pon04514   Cell adhesion molecules pon04530   Tight junction pon04670   Leukocyte transendothelial migration pon05160   Hepatitis C Brite KEGG Orthology (KO) [BR:pon00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     100451146  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     100451146  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     100451146  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     100451146   09158 Development and regeneration    04382 Cornified envelope formation     100451146  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     100451146  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pon03037]     100451146    04147 Exosome [BR:pon04147]     100451146    04515 Cell adhesion molecules [BR:pon04515]     100451146 Cilium and associated proteins [BR:pon03037]  Other cilia and associated proteins   Stereociliary proteins    100451146 Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    100451146   Exosomal proteins of colorectal cancer cells    100451146 Cell adhesion molecules [BR:pon04515]  Immunoglobulin superfamily   L1 family    100451146 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 GPDPase_memb Pox_A14 DUF4064 MFS_MOT1 TMEM100 Motif Other DBs NCBI-GeneID:  100451146 NCBI-ProteinID:  XP_054407592 LinkDB All DBs Position 1:94998495..95000025 Genome browser AA seq 116 aa AA seqDB search MSCVVQSSGQMQCKVYNSLLALPQDLQAACAICVITLLVALFGLLVYLAGAKCTTCVEEK DSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKWELGASLYLG NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgtcctgcgtggtgcagagcagcggccagatgcagtgcaaggtgtacaattcactgctg gcgctgccgcaggacttgcaggctgcatgtgccatctgtgtcatcaccctccttgtggcc ctgttcggcttgctggtctaccttgctggggccaagtgtaccacctgtgtggaggagaag gattccaaggcccgcctggtgctcacctctgggattgtctttgtcatctcaggggtcctg acgctaatccccgtttgctggacagcgcatgccatcatccgggacttctataaccccctg gtggctgaggcccaaaagtgggagctgggggcctccctctacttgggctag

DBGET integrated database retrieval system