Pongo abelii (Sumatran orangutan): 100452990 Help Entry 100452990         CDS       T01416                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04066   HIF-1 signaling pathway pon04120   Ubiquitin mediated proteolysis pon05170   Human immunodeficiency virus 1 infection pon05200   Pathways in cancer pon05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:pon00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100452990  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     100452990  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100452990   09162 Cancer: specific types    05211 Renal cell carcinoma     100452990   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100452990  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pon04121]     100452990    03400 DNA repair and recombination proteins [BR:pon03400]     100452990 Ubiquitin system [BR:pon04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      100452990    Cul5 complex      100452990 DNA repair and recombination proteins [BR:pon03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      100452990 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  100452990 NCBI-ProteinID:  XP_054379097 Ensembl:  ENSPPYG00000036463 LinkDB All DBs Position 8:10308744..10309118 Genome browser AA seq 115 aa AA seqDB search MDGEEKTFGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKATLSGPGQFAVSETSEV NFREIPSCALSKVCTYFTYKVRYPNSSTKVPELPIAPEIALELLMDVSFLDCEIK NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggatggagaggagaaaacctttggtggctgtgaaggccctgatgcgatgtatgtgaag ttgatatcatctgatggccatgaatttattgtaaaaagggaacatgcattaacatcaggc acaataaaagccacattgagtggcccaggtcaatttgctgtgagtgaaaccagtgaggtc aattttagagagataccttcgtgtgcgctatcaaaagtatgcacgtattttacgtataaa gttcgctaccctaacagctccaccaaggttccggagctcccaattgcacctgaaattgca ctagaactgttaatggatgtgagcttcctagattgtgaaataaaataa

DBGET integrated database retrieval system