Pongo abelii (Sumatran orangutan): 100453051 Help Entry 100453051         CDS       T01416                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon01521   EGFR tyrosine kinase inhibitor resistance pon01524   Platinum drug resistance pon04014   Ras signaling pathway pon04064   NF-kappa B signaling pathway pon04115   p53 signaling pathway pon04137   Mitophagy - animal pon04140   Autophagy - animal pon04151   PI3K-Akt signaling pathway pon04210   Apoptosis pon04215   Apoptosis - multiple species pon04621   NOD-like receptor signaling pathway pon04630   JAK-STAT signaling pathway pon05012   Parkinson disease pon05014   Amyotrophic lateral sclerosis pon05022   Pathways of neurodegeneration - multiple diseases pon05145   Toxoplasmosis pon05162   Measles pon05166   Human T-cell leukemia virus 1 infection pon05168   Herpes simplex virus 1 infection pon05170   Human immunodeficiency virus 1 infection pon05200   Pathways in cancer pon05202   Transcriptional misregulation in cancer pon05212   Pancreatic cancer pon05220   Chronic myeloid leukemia pon05222   Small cell lung cancer pon05225   Hepatocellular carcinoma pon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100453051 (BCL2L1)    04630 JAK-STAT signaling pathway     100453051 (BCL2L1)    04064 NF-kappa B signaling pathway     100453051 (BCL2L1)    04151 PI3K-Akt signaling pathway     100453051 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100453051 (BCL2L1)    04137 Mitophagy - animal     100453051 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     100453051 (BCL2L1)    04215 Apoptosis - multiple species     100453051 (BCL2L1)    04115 p53 signaling pathway     100453051 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100453051 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100453051 (BCL2L1)    05202 Transcriptional misregulation in cancer     100453051 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     100453051 (BCL2L1)    05225 Hepatocellular carcinoma     100453051 (BCL2L1)    05220 Chronic myeloid leukemia     100453051 (BCL2L1)    05222 Small cell lung cancer     100453051 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100453051 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     100453051 (BCL2L1)    05162 Measles     100453051 (BCL2L1)    05168 Herpes simplex virus 1 infection     100453051 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100453051 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     100453051 (BCL2L1)    05014 Amyotrophic lateral sclerosis     100453051 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     100453051 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100453051 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100453051 (BCL2L1)    01524 Platinum drug resistance     100453051 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pon01009]     100453051 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pon03036]     100453051 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pon02000]     100453051 (BCL2L1) Protein phosphatases and associated proteins [BR:pon01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      100453051 (BCL2L1) Chromosome and associated proteins [BR:pon03036]  Eukaryotic type   Centrosome formation proteins    Other centriole associated proteins     100453051 (BCL2L1) Transporters [BR:pon02000]  Other transporters   Pores ion channels [TC:1]    100453051 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  100453051 NCBI-ProteinID:  XP_003780406 LinkDB All DBs Position 20:complement(28042160..28099229) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccagaaggg actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggcg gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg taccggcgggcattcagtgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggattgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggatacttttgtggaactctatgggaacaatgcagca gctgagagccgaaagggccaggaacgcttcaaccgctggttcctgacgggcatgactgtg gccggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system