Pongo abelii (Sumatran orangutan): 100454009 Help Entry 100454009         CDS       T01416                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04010   MAPK signaling pathway pon04060   Cytokine-cytokine receptor interaction pon04217   Necroptosis pon04218   Cellular senescence pon04380   Osteoclast differentiation pon04640   Hematopoietic cell lineage pon04932   Non-alcoholic fatty liver disease pon04933   AGE-RAGE signaling pathway in diabetic complications pon04940   Type I diabetes mellitus pon05010   Alzheimer disease pon05020   Prion disease pon05022   Pathways of neurodegeneration - multiple diseases pon05133   Pertussis pon05140   Leishmaniasis pon05152   Tuberculosis pon05162   Measles pon05164   Influenza A pon05321   Inflammatory bowel disease pon05323   Rheumatoid arthritis pon05332   Graft-versus-host disease pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100454009 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100454009 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100454009 (IL1A)    04218 Cellular senescence     100454009 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100454009 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     100454009 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     100454009 (IL1A)    05162 Measles     100454009 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     100454009 (IL1A)    05152 Tuberculosis     100454009 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100454009 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     100454009 (IL1A)    05321 Inflammatory bowel disease     100454009 (IL1A)    05332 Graft-versus-host disease     100454009 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     100454009 (IL1A)    05020 Prion disease     100454009 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     100454009 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100454009 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100454009 (IL1A)    04932 Non-alcoholic fatty liver disease     100454009 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     100454009 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100454009 (IL1A) Cytokines and neuropeptides [BR:pon04052]  Cytokines   Interleukins    100454009 (IL1A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1_propep IL1 Motif Other DBs NCBI-GeneID:  100454009 NCBI-ProteinID:  XP_002811834 Ensembl:  ENSPPYG00000012173 UniProt:  H2P5G1 LinkDB All DBs Position 12:complement(42702354..42712384) Genome browser AA seq 271 aa AA seqDB search MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS KTSRLTFMESMVVVATNGKVLKKRRLSLSQSITDDDLQAIANGSEEEIIKPRSAPFSFLS NVKYNFMRIIKHEFILNDALNQSIIRANDQYLTVAALHNLDEAVKFDMGAYKSSKDDAKI TVILRISKTQLYVSAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP NLFIATKQDYWVCLAGGPPSITDFQILENQA NT seq 816 nt NT seq  +upstreamnt  +downstreamnt atggccaaagttccagacatgtttgaagacctgaagaactgttacagtgaaaatgaagaa gacagttcctccattgatcatctgtctctgaatcagaaatccttctatcatgtaagctat ggcccactccatgaaggctgcatggatcagtctgtgtctctgagtatctctgaaacctct aaaacatccaggcttaccttcatggagagcatggtggtagtagcgaccaacgggaaggtt ctgaagaagagacggttgagtttaagccaatccatcactgatgatgacctgcaggccatc gccaacggctcagaggaagaaatcatcaagcctaggtcagcacctttcagcttcctgagc aatgtgaaatacaactttatgaggatcatcaaacacgaattcatcctgaatgatgccctc aatcaaagtataattcgagccaatgatcagtacctcacagttgctgcattacataatctg gatgaagcagtgaaatttgacatgggtgcttataagtcatcaaaggatgatgctaaaatt accgtgattctaagaatctcaaaaactcaattgtatgtgagtgcccaagatgaagaccaa ccggtgctgctgaaggagatgcctgaaatacccaaaaccatcacaggtagtgagaccaac ctcctcttcttctgggaaactcacggcactaagaactacttcacatcagttgcccatcca aacttgtttattgccacaaagcaagactactgggtgtgcttggcaggggggccaccctct atcactgactttcagatactggaaaaccaggcttag

DBGET integrated database retrieval system