Pongo abelii (Sumatran orangutan): 100454188 Help Entry 100454188         CDS       T01416                                  Name (RefSeq) histone H2A.V isoform X2   KO K11251   histone H2A Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon03082   ATP-dependent chromatin remodeling pon04217   Necroptosis pon04613   Neutrophil extracellular trap formation pon05034   Alcoholism pon05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pon00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100454188  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100454188  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100454188  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     100454188   09165 Substance dependence    05034 Alcoholism     100454188  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pon03036]     100454188   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pon04147]     100454188 Chromosome and associated proteins [BR:pon03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100454188 Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100454188 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone Motif Other DBs NCBI-GeneID:  100454188 NCBI-ProteinID:  XP_024105425 Ensembl:  ENSPPYG00000017585 LinkDB All DBs Position 6:40212593..40226508 Genome browser AA seq 90 aa AA seqDB search MAGGKAGKDSGKAKAKAVSRSQRAGLQVLELAGNASKDLKVKRITPRHLQLAIRGDEELD SLIKATIAGGGVIPHIHKSLIGKKGQQKTA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggctggaggcaaagctggaaaggacagtgggaaggccaaggctaaggcagtatctcgc tcacagagagctgggctacaggtgctggagctggcaggtaatgcttctaaggatctcaaa gtaaagcgtatcactccgcgtcacttgcagcttgcaatccgtggtgatgaagagttggat tctcttatcaaggctaccatagctgggggtggtgtgatccctcacatccacaaatctctg attggaaagaagggacagcagaaaactgcttag

DBGET integrated database retrieval system