Pongo abelii (Sumatran orangutan): 100454280 Help Entry 100454280         CDS       T01416                                  Symbol LHB Name (RefSeq) lutropin subunit beta   KO K08521   lutropin subunit beta Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04024   cAMP signaling pathway pon04080   Neuroactive ligand-receptor interaction pon04912   GnRH signaling pathway pon04913   Ovarian steroidogenesis pon04917   Prolactin signaling pathway pon04929   GnRH secretion Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     100454280 (LHB)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100454280 (LHB)  09150 Organismal Systems   09152 Endocrine system    04929 GnRH secretion     100454280 (LHB)    04912 GnRH signaling pathway     100454280 (LHB)    04913 Ovarian steroidogenesis     100454280 (LHB)    04917 Prolactin signaling pathway     100454280 (LHB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100454280 (LHB) Cytokines and neuropeptides [BR:pon04052]  Neuropeptides   Neuropeptides (GPCR binding)    100454280 (LHB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cys_knot Motif Other DBs NCBI-GeneID:  100454280 NCBI-ProteinID:  XP_024092822 LinkDB All DBs Position 19:complement(47388837..47389933) Genome browser AA seq 141 aa AA seqDB search MEMLQGLLLLMLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT MTRVLQSVLPPLPQVVCNYRDVRFESIWLPGCPRGVDPVVSYAVALSCHCGLCRRSTSDC GGPKDHPLTCDHPQLPGLLFL NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atggagatgctccaggggctgctgctgttgatgctgctgagcatgggcgggacatgggca tccaaggagccgcttcggccacggtgccgccccatcaatgccaccctggctgtcgagaag gagggctgccccgtgtgcatcaccgtcaacaccaccatctgtgccggctactgccccacc atgacgcgcgtgctgcagtcggtcctgccgcccctgcctcaggtggtgtgcaactaccgc gatgtgcgcttcgagtctatctggctccctggctgcccgcgtggtgtggaccccgtggtc tcctacgccgtggctctcagctgtcactgtggactctgccgccgcagcacctctgactgt gggggtcccaaggaccaccccttgacctgtgaccacccccaactcccaggcctcctcttc ctctaa

DBGET integrated database retrieval system