Pongo abelii (Sumatran orangutan): 100454905 Help Entry 100454905         CDS       T01416                                  Symbol FGF16 Name (RefSeq) fibroblast growth factor 16   KO K04358   fibroblast growth factor Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04010   MAPK signaling pathway pon04014   Ras signaling pathway pon04015   Rap1 signaling pathway pon04020   Calcium signaling pathway pon04151   PI3K-Akt signaling pathway pon04810   Regulation of actin cytoskeleton pon05200   Pathways in cancer pon05207   Chemical carcinogenesis - receptor activation pon05218   Melanoma pon05224   Breast cancer pon05226   Gastric cancer Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100454905 (FGF16)    04014 Ras signaling pathway     100454905 (FGF16)    04015 Rap1 signaling pathway     100454905 (FGF16)    04020 Calcium signaling pathway     100454905 (FGF16)    04151 PI3K-Akt signaling pathway     100454905 (FGF16)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100454905 (FGF16)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100454905 (FGF16)    05207 Chemical carcinogenesis - receptor activation     100454905 (FGF16)   09162 Cancer: specific types    05226 Gastric cancer     100454905 (FGF16)    05218 Melanoma     100454905 (FGF16)    05224 Breast cancer     100454905 (FGF16)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100454905 (FGF16)    00536 Glycosaminoglycan binding proteins [BR:pon00536]     100454905 (FGF16) Cytokines and neuropeptides [BR:pon04052]  Cytokines   Growth factors (RTK binding)    100454905 (FGF16) Glycosaminoglycan binding proteins [BR:pon00536]  Heparan sulfate / Heparin   Growth factors/receptors    100454905 (FGF16) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  100454905 NCBI-ProteinID:  XP_002831878 Ensembl:  ENSPPYG00000036906 UniProt:  H2PW31 LinkDB All DBs Position X:82397011..82406962 Genome browser AA seq 207 aa AA seqDB search MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH QKFTHFLPRPVDPSKLPSMSRDLFHYR NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcagaggtggggggcgtcttcgcctccttggactgggatctacacggcttctcctca tctctggggaacgtgcccttagctgactccccaggtttcctgaacgagcgcctgggccaa atcgaggggaagctgcagcgtggctcacccacagacttcgcccacctgaaggggatcctg cggcgccgccagctctactgccgcaccggcttccacctggagatcttccccaacggcacg gtgcacggcacccgccacgaccacagccgcttcggaatcctggagtttatcagcctggct gtggggctgatcagcatccggggagtggactctggcctgtacctaggaatgaatgagcga ggagaactctatgggtcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaa gaaaactggtacaatacctatgcttcaaccttgtacaaacattcggactcggagagacag tattacgtggccctgaacaaagatggctcaccccgggagggatacaggactaaacgacac cagaaattcactcactttttacccaggcctgtagatccttctaagttgccctccatgtcc agagacctctttcactataggtaa

DBGET integrated database retrieval system