Pongo abelii (Sumatran orangutan): 100455006 Help Entry 100455006         CDS       T01416                                  Name (RefSeq) histone H2B type 1-K-like   KO K11252   histone H2B Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04613   Neutrophil extracellular trap formation pon05034   Alcoholism pon05203   Viral carcinogenesis pon05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pon00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100455006  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100455006   09163 Immune disease    05322 Systemic lupus erythematosus     100455006   09165 Substance dependence    05034 Alcoholism     100455006  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pon03036]     100455006   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pon04147]     100455006 Chromosome and associated proteins [BR:pon03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100455006 Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100455006 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF ARM_TT21 TFIID_20kDa Motif Other DBs NCBI-GeneID:  100455006 NCBI-ProteinID:  XP_002813319 LinkDB All DBs Position 2:24022975..24023370 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPDPNKGSKRWVTKAQKKDGKKHKRSRKASYSVYLYKVLRQVHSDTGISSKAM GIMNSFVNHIFERVAGETSRLVHYNKRSTITSREIQTAVRLLLLGEVAKHAVSEGTKAIT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccagagccagcaaagtccgctcctgatcctaataagggctccaagaggtgggtgact aaggcgcagaagaaggacggcaagaagcacaagcgcagccgcaaggcgagctactccgtg tacttgtacaaggtgctgaggcaggtccactccgacaccggcatctcctctaaggccatg gggatcatgaactccttcgtcaaccacatcttcgagcgcgtcgcgggcgagacttcccgc ctggtgcactacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc ctgctgctgctcggggaggtggccaagcacgccgtgtccgagggcaccaaggccatcacc aagtataccagcgctaagtaa

DBGET integrated database retrieval system