KEGG   Pongo abelii (Sumatran orangutan): 100455662
Entry
100455662         CDS       T01416                                 
Name
(RefSeq) calmodulin-alpha-like
  KO
K02183  calmodulin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04722  Neurotrophin signaling pathway
pon04728  Dopaminergic synapse
pon04740  Olfactory transduction
pon04744  Phototransduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04910  Insulin signaling pathway
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05133  Pertussis
pon05152  Tuberculosis
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05214  Glioma
pon05417  Lipid and atherosclerosis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100455662
   04015 Rap1 signaling pathway
    100455662
   04371 Apelin signaling pathway
    100455662
   04020 Calcium signaling pathway
    100455662
   04070 Phosphatidylinositol signaling system
    100455662
   04024 cAMP signaling pathway
    100455662
   04022 cGMP-PKG signaling pathway
    100455662
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100455662
   04218 Cellular senescence
    100455662
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100455662
  09152 Endocrine system
   04910 Insulin signaling pathway
    100455662
   04922 Glucagon signaling pathway
    100455662
   04912 GnRH signaling pathway
    100455662
   04915 Estrogen signaling pathway
    100455662
   04921 Oxytocin signaling pathway
    100455662
   04916 Melanogenesis
    100455662
   04924 Renin secretion
    100455662
   04925 Aldosterone synthesis and secretion
    100455662
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100455662
   04270 Vascular smooth muscle contraction
    100455662
  09154 Digestive system
   04970 Salivary secretion
    100455662
   04971 Gastric acid secretion
    100455662
  09156 Nervous system
   04728 Dopaminergic synapse
    100455662
   04720 Long-term potentiation
    100455662
   04722 Neurotrophin signaling pathway
    100455662
  09157 Sensory system
   04744 Phototransduction
    100455662
   04740 Olfactory transduction
    100455662
   04750 Inflammatory mediator regulation of TRP channels
    100455662
  09159 Environmental adaptation
   04713 Circadian entrainment
    100455662
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100455662
  09162 Cancer: specific types
   05214 Glioma
    100455662
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100455662
   05163 Human cytomegalovirus infection
    100455662
   05167 Kaposi sarcoma-associated herpesvirus infection
    100455662
  09171 Infectious disease: bacterial
   05133 Pertussis
    100455662
   05152 Tuberculosis
    100455662
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100455662
   05012 Parkinson disease
    100455662
   05022 Pathways of neurodegeneration - multiple diseases
    100455662
  09165 Substance dependence
   05031 Amphetamine addiction
    100455662
   05034 Alcoholism
    100455662
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100455662
   05418 Fluid shear stress and atherosclerosis
    100455662
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100455662
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100455662
   03036 Chromosome and associated proteins [BR:pon03036]
    100455662
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100455662
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100455662
Membrane trafficking [BR:pon04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100455662
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     100455662
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100455662
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF-hand_11 EF_EFCAB10_C TerB FCaBP_EF-hand EFhand_Ca_insen DUF1103 Dockerin_1 PA_Ig-like SurA_N_3
Other DBs
NCBI-GeneID: 100455662
NCBI-ProteinID: XP_009242176
Ensembl: ENSPPYG00000018706
UniProt: H2PQN8
LinkDB
Position
7:96920824..96921383
AA seq 149 aa
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGAVLRSLVQNPTEAELQDVINGVDADG
NGTIDFPEFLTKMARKMKDTDSEEEIREAFHVFDKDGNGYISAAELCHVMTNLGEKLTDE
EVDEMIREADIDGNGQVNYEEFAQMMTAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgaccaactgactgaagagcagattgcagaattcaaagaagctttttcactattt
gacaaagatggtgatggaactataacaacaaaggaattgggagctgtgctgaggtctctt
gtacagaatcctacagaagcagagttacaggatgtgattaatggagtagatgctgatggt
aatggcacaattgacttccctgaatttctgacaaagatggcaagaaaaatgaaagacaca
gacagtgaagaagaaattagagaagcattccatgtgtttgataaagatggcaatggctat
attagtgctgcagaactttgtcatgtgatgacaaaccttggagagaagttaacagatgaa
gaagttgatgaaatgatcagggaagcagatattgatggcaatggtcaagtaaactatgaa
gagtttgcacaaatgatgacagcaaagtga

DBGET integrated database retrieval system