Pongo abelii (Sumatran orangutan): 100455740 Help Entry 100455740         CDS       T01416                                  Symbol MYL5 Name (RefSeq) myosin light chain 5   KO K12753   myosin regulatory light chain 5 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04360   Axon guidance pon04510   Focal adhesion pon04520   Adherens junction pon04670   Leukocyte transendothelial migration pon04810   Regulation of actin cytoskeleton pon04814   Motor proteins pon04820   Cytoskeleton in muscle cells pon05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pon00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     100455740 (MYL5)    04520 Adherens junction     100455740 (MYL5)   09142 Cell motility    04814 Motor proteins     100455740 (MYL5)    04820 Cytoskeleton in muscle cells     100455740 (MYL5)    04810 Regulation of actin cytoskeleton     100455740 (MYL5)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     100455740 (MYL5)   09158 Development and regeneration    04360 Axon guidance     100455740 (MYL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100455740 (MYL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pon04812]     100455740 (MYL5) Cytoskeleton proteins [BR:pon04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      100455740 (MYL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 EF_EFCAB10_C Lipoprotein_6 Caleosin AIF-1 Motif Other DBs NCBI-GeneID:  100455740 NCBI-ProteinID:  XP_002814535 Ensembl:  ENSPPYG00000014506 UniProt:  A0A2J8SSF7 H2PCM0 LinkDB All DBs Position 3:660926..666687 Genome browser AA seq 173 aa AA seqDB search MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI NKEYIKRLLMSQADKMTAEEVDQMFQFASIDAAGNLDYKALSYVITHGEEKEE NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atggccagtaggaagaccaagaagaaggaagggggtgccctccgggcccagagagcctca tccaatgtcttctccaactttgagcagactcagatccaggagttcaaggaggcattcaca ctcatggatcagaaccgagatggcttcattgacaaggaggacctgaaggacacctacgcc tccctgggcaagaccaacgtcaaggacgacgagctggatgccatgctcaaagaggcctca gggcccatcaacttcaccatgtttctgaacctgtttggggagaagctgagcggtaccgac gccgaggagaccattctaaacgccttcaagatgctggacccggacggaaaagggaaaatc aacaaggagtacatcaagcgtctgctgatgtcccaggctgacaagatgacagcggaagag gtggaccagatgttccagttcgcttccatcgatgcagcgggcaacctggactacaaggcg ctcagctacgtgatcacccacggggaggagaaggaggagtga

DBGET integrated database retrieval system