Pongo abelii (Sumatran orangutan): 100458037 Help Entry 100458037         CDS       T01416                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04621   NOD-like receptor signaling pathway pon05012   Parkinson disease pon05132   Salmonella infection pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100458037  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100458037   09164 Neurodegenerative disease    05012 Parkinson disease     100458037   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100458037  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pon03110]     100458037 Chaperones and folding catalysts [BR:pon03110]  Protein folding catalysts   Protein disulfide isomerase    100458037 SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_7 Thioredoxin_8 Glutaredoxin OST3_OST6 DIM1 A6-like_Thioredoxin-like_C Redoxin SCO2_C Thioredoxin_5 Motif Other DBs NCBI-GeneID:  100458037 NCBI-ProteinID:  XP_054410075 Ensembl:  ENSPPYG00000014865 UniProt:  H2PDP6 LinkDB All DBs Position 3:complement(98149011..98149353) Genome browser AA seq 104 aa AA seqDB search MVKQIKSKVAFQEALDTAGNKLVVDFSATWCGPCKMIKSFFHSLSEKYSNVVFLEVDVDD CQDVALEWEVKCMPTFQFFNKGQKVGEFSGANKKKLEATINELV NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggtaaaacagatcaagagcaaggttgcttttcaggaagccttggacaccgcaggcaat aaacttgtagttgacttctcagccacatggtgtgggccttgcaaaatgatcaagtctttc tttcattccctctctgaaaagtattccaacgtggtattccttgaagtagatgtggatgac tgtcaggatgttgctttagagtgggaagtcaaatgcatgccaacattccagttttttaac aagggacaaaaggtgggtgaattttctggggccaataagaaaaagcttgaagccaccatt aatgaattagtctaa

DBGET integrated database retrieval system