| Entry |
|
|---|
| Symbol |
FCER1G
|
|---|
| Name |
(RefSeq) high affinity immunoglobulin epsilon receptor subunit gamma
|
|---|
| KO |
| K07983 | high affinity immunoglobulin epsilon receptor subunit gamma |
|
|---|
| Organism |
pon Pongo abelii (Sumatran orangutan)
|
|---|
| Pathway |
| pon04072 | Phospholipase D signaling pathway |
| pon04625 | C-type lectin receptor signaling pathway |
| pon04650 | Natural killer cell mediated cytotoxicity |
| pon04664 | Fc epsilon RI signaling pathway |
|
|---|
| Brite |
KEGG Orthology (KO) [BR:pon00001]
09130 Environmental Information Processing
09132 Signal transduction
04072 Phospholipase D signaling pathway
100461915 (FCER1G)
04071 Sphingolipid signaling pathway
100461915 (FCER1G)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
100461915 (FCER1G)
04625 C-type lectin receptor signaling pathway
100461915 (FCER1G)
04650 Natural killer cell mediated cytotoxicity
100461915 (FCER1G)
04664 Fc epsilon RI signaling pathway
100461915 (FCER1G)
09160 Human Diseases
09171 Infectious disease: bacterial
05152 Tuberculosis
100461915 (FCER1G)
09163 Immune disease
05310 Asthma
100461915 (FCER1G)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:pon04147]
100461915 (FCER1G)
Exosome [BR:pon04147]
Exosomal proteins
Exosomal proteins of microglial cells
100461915 (FCER1G)
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| Position |
1:complement(89134154..89138069)
|
|---|
| AA seq |
86 aa
MIPAVVLLLLLLVEQTVALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAIASYEK
SDGVYTGLSTRNQETYETLKHEKPPQ |
|---|
| NT seq |
261 nt +upstreamnt +downstreamnt
atgattccagcagtggtcttgctcttactccttttggttgaacaaacagtggccctggga
gagcctcagctctgctatatcctggatgccatcctgtttctgtatggaattgtcctcacc
ctcctctactgtcgactgaagatccaagtgcgaaaagcagctatagccagctatgagaaa
tcagatggtgtttacacgggcctgagcaccaggaaccaggagacttacgagactctgaag
catgagaaaccaccacagtag |
|---|
