Pongo abelii (Sumatran orangutan): 103889286 Help Entry 103889286         CDS       T01416                                  Name (RefSeq) histone H3.Y   KO K11253   histone H3 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04613   Neutrophil extracellular trap formation pon05034   Alcoholism pon05202   Transcriptional misregulation in cancer pon05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pon00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103889286  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103889286   09163 Immune disease    05322 Systemic lupus erythematosus     103889286   09165 Substance dependence    05034 Alcoholism     103889286  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pon03036]     103889286   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pon04147]     103889286 Chromosome and associated proteins [BR:pon03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103889286 Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103889286 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF TMA7 CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  103889286 NCBI-ProteinID:  XP_024103135 Ensembl:  ENSPPYG00000032677 LinkDB All DBs Position 4:complement(17985461..17986760) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKATAWQAPRKPLATKAAGKRALPTGGIKKPHRYKPGTVALREIRKYQKSTQ LLLRKLPFQRLVREIAQAISPDVRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTI MPRDMQLARRLRGEGP NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcaccaagcagaccgcccgcaaagccaccgcctggcaggcccccaggaagcca ctggccaccaaagccgccggaaaaagggcgctgcctacaggagggatcaagaagcctcac cgctacaagcctggcaccgtggccttacgcgaaatcagaaagtaccagaagtccactcag ctgctcttgcgcaagctgcccttccagcgcctggtgcgcgagatcgcccaggccatcagc ccggacgtgcgcttccagagcgcggccattggcgccctgcaggaggccagcgaggcctac ctggtgcaactctttgaagacaccaacctgtgtgccatccatgccaggcgcgtcacaatt atgcccagagacatgcagctggcccgccgcctccgcggagagggtccttaa

DBGET integrated database retrieval system