Pongo abelii (Sumatran orangutan): 112133748 Help Entry 112133748         CDS       T01416                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04613   Neutrophil extracellular trap formation pon05034   Alcoholism pon05203   Viral carcinogenesis pon05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pon00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112133748  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     112133748   09163 Immune disease    05322 Systemic lupus erythematosus     112133748   09165 Substance dependence    05034 Alcoholism     112133748  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pon03036]     112133748 Chromosome and associated proteins [BR:pon03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112133748 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  112133748 NCBI-ProteinID:  XP_054414533 Ensembl:  ENSPPYG00000030792 UniProt:  Q5RCS7 LinkDB All DBs Position 5:27031966..27033195 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcaggacgcggcaaaggaggtaagggcctggggaaagggggtgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagccagccattcggcgccttgctcgc cgcggcggcgtgaagcgcatctctggcctcatctatgaggagacccgcggggtgctgaag gtgttcttggagaacgtgatccgggacgccgtgacctacacggagcacgccaagcgcaag acggtcaccgccatggacgtggtctacgcactcaaacgtcagggccgcaccctctatggc ttcggcggctaa

DBGET integrated database retrieval system