Pongo abelii (Sumatran orangutan): 112135455 Help Entry 112135455         CDS       T01416                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04382   Cornified envelope formation pon05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pon00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     112135455  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112135455  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pon04147]     112135455 Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of microglial cells    112135455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 Motif Other DBs NCBI-GeneID:  112135455 NCBI-ProteinID:  XP_054413872 LinkDB All DBs Position 1:complement(232435261..232435801) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFFLSAGLSIACHDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacacgccatggaaaccatgatgtttacatttcacaaattcgct ggggataaaggctacttaacaaaggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggctgtggacaaaataatgaaggacctggac cagtgcagagatggcaaagtgggcttccagagcttctttttcctaagtgcgggcctcagc attgcatgccatgactattttgtagtacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system