Pongo abelii (Sumatran orangutan): 129049374 Help Entry 129049374         CDS       T01416                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04613   Neutrophil extracellular trap formation pon05034   Alcoholism pon05202   Transcriptional misregulation in cancer pon05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pon00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129049374  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     129049374   09163 Immune disease    05322 Systemic lupus erythematosus     129049374   09165 Substance dependence    05034 Alcoholism     129049374  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pon03036]     129049374   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pon04147]     129049374 Chromosome and associated proteins [BR:pon03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129049374 Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129049374 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  129049374 NCBI-ProteinID:  XP_063583897 UniProt:  H2PUI4 LinkDB All DBs Position 1:complement(100816560..100816970) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgtactaagcagactgcccgcaagtcgaccggcggcaaggccccgaggaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggggtgaagaagccgcac cgctaccggcccggcaccgtggccctgcgggagatccggcgctaccagaagtccacggag ctgctgatccgcaagctgcccttccagcggctggtacgcgagatcgcgcaggactttaag acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggccagcgaggcctac ctggtggggctgttcgaagacacaaacctgtgcgccatccacgccaagcgcgtgaccatt atgcccaaggacatccagctggcccgccgcatccgtggagagcgggcttaa

DBGET integrated database retrieval system