Pontibacter sp. SGAir0037: C1N53_00135 Help Entry C1N53_00135       CDS       T09933                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pont  Pontibacter sp. SGAir0037 Pathway pont01100   Metabolic pathways pont01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pont00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C1N53_00135    00074 Mycolic acid biosynthesis     C1N53_00135   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C1N53_00135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QCR20923 LinkDB All DBs Position 29549..29785 Genome browser AA seq 78 aa AA seqDB search MSEIAEKVKAIIIDKLGVEESEVTPEASFTNDLGADSLDTVELIMEFEKEFNVSIPDDQA ENIATVGQAISYLEEHAK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcagaaatcgcagaaaaagtaaaagctatcatcatcgataagctgggcgttgaagag tcagaggttactccagaggctagcttcacaaacgatcttggtgctgattcactagatact gttgagcttatcatggaatttgagaaagagttcaacgtatctattccagatgatcaggcc gaaaatattgctacagtaggtcaggctattagctacttggaagagcacgctaagtaa

DBGET integrated database retrieval system