Polaromonas sp. Pch-P: F7R28_01560 Help Entry F7R28_01560       CDS       T06273                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism poo  Polaromonas sp. Pch-P Pathway poo01100   Metabolic pathways poo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:poo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F7R28_01560    00074 Mycolic acid biosynthesis     F7R28_01560   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F7R28_01560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Glyco_hydro_63 Motif Other DBs NCBI-ProteinID:  QGJ17197 LinkDB All DBs Position 353614..353853 Genome browser AA seq 79 aa AA seqDB search MNSDLINLFAETFGISEDKLLPDATLESLGLDSLAVIEFLFQIEDQFGIQIPDQANPPRT LAEMVQLIEPLLPAGKPAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaattctgatttgatcaatctttttgccgagacatttggcatcagcgaagacaaactg ctgccggatgcgacgctggaaagcctggggctcgactcgctggcggtcatcgaattcctg ttccagatcgaagaccagttcggcatccagattcccgaccaggccaacccgccccgcacc cttgcggaaatggtccagctgatcgagcctttgctgccggcgggcaaaccagccgcctga

DBGET integrated database retrieval system