Polaromonas sp. Pch-P: F7R28_09470 Help Entry F7R28_09470       CDS       T06273                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism poo  Polaromonas sp. Pch-P Brite KEGG Orthology (KO) [BR:poo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:poo03036]     F7R28_09470    03400 DNA repair and recombination proteins [BR:poo03400]     F7R28_09470 Chromosome and associated proteins [BR:poo03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     F7R28_09470 DNA repair and recombination proteins [BR:poo03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       F7R28_09470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Motif Other DBs NCBI-ProteinID:  QGJ18598 UniProt:  A0A5Q3HAL1 LinkDB All DBs Position 2001075..2001365 Genome browser AA seq 96 aa AA seqDB search MSSLDELIAQRDALEKKIADMQRKKKADVIIQVKALISQNGLTQGDLFGSISKARKSTAG NTVPAKYKDPESDAMWSGRGKAPAWIVGKDRTKFLI NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtcctctcttgacgaactgatagcccagcgcgatgcactcgaaaaaaaaatcgcagac atgcaaagaaagaaaaaagcggatgtcatcattcaagtgaaagccttgatttctcagaat ggcctaactcaaggtgatttatttggcagtatttcaaaggcacgaaaaagcactgccggc aatacagttcccgccaaatacaaagacccggaatccgatgccatgtggtcagggcgcggt aaagcaccggcctggatcgttggcaaggataggaccaagttcctaatttag

DBGET integrated database retrieval system