Polaromonas sp. Pch-P: F7R28_18435 Help Entry F7R28_18435       CDS       T06273                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism poo  Polaromonas sp. Pch-P Pathway poo01100   Metabolic pathways poo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:poo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F7R28_18435 (acpP)    00074 Mycolic acid biosynthesis     F7R28_18435 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F7R28_18435 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QGJ20172 LinkDB All DBs Position complement(3921177..3921416) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEEGQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgttaagaaaatcattgccgagcaacttggcgtggaagaa ggccaagtcaccaatgaaaaagcctttgtggccgatctgggcgctgactcgcttgacacc gtagaactggttatggctctggaagacgagtttggcattgagattcccgacgaagacgcc gagaaaatcacgaccgtccagaacgcgattgactacgcaaacacccatcaaaaggcctga

DBGET integrated database retrieval system