Polaromonas sp. Pch-P: F7R28_19825 Help Entry F7R28_19825       CDS       T06273                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism poo  Polaromonas sp. Pch-P Brite KEGG Orthology (KO) [BR:poo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:poo03110]     F7R28_19825 (grxC) Chaperones and folding catalysts [BR:poo03110]  Protein folding catalysts   Protein disulfide isomerase    F7R28_19825 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_3 Thioredoxin_2 GST_N_3 Glrx-like GST_N_2 Motif Other DBs NCBI-ProteinID:  QGJ20417 UniProt:  A0A5Q3HEY3 LinkDB All DBs Position complement(4233124..4233387) Genome browser AA seq 87 aa AA seqDB search MQTVKIYTTGTCPYCIQAKQLLKQRGVTELDEIRVDMEPGERQKMMEITGRRTVPQIFIG ETHVGGCDDLMALDGRGGLMPLLNPAA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcaaaccgtcaagatctacaccaccggcacctgcccttactgcatccaggccaaacag ttgctcaagcagcgcggcgtcaccgaactcgatgaaatccgcgtcgacatggaacccggc gagcgccagaagatgatggaaatcaccggccggcgcaccgtgccgcaaatcttcatcggc gaaacccacgtcggcggctgcgacgacctgatggccctggacggccgcggcggcctgatg ccccttctgaaccccgccgcttga

DBGET integrated database retrieval system