Populus trichocarpa (black cottonwood): 18094708 Help Entry 18094708          CDS       T01077                                  Name (RefSeq) sm-like protein LSM1B isoform X1   KO K12620   U6 snRNA-associated Sm-like protein LSm1 Organism pop  Populus trichocarpa (black cottonwood) Pathway pop03018   RNA degradation Brite KEGG Orthology (KO) [BR:pop00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     18094708  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pop03019]     18094708 Messenger RNA biogenesis [BR:pop03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      18094708   mRNA degradation factors    5'-3' decay     Lsm complex      18094708 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Hfq Motif Other DBs NCBI-GeneID:  18094708 NCBI-ProteinID:  XP_006369123 UniProt:  B9N7F0 LinkDB All DBs Position 1:complement(14183195..14186757) Genome browser AA seq 128 aa AA seqDB search MSWAGPEDIYLSTSLANYLDKKLLVLLRDGRKLMGLLRSFDQFANAVLEGACERVIVGDL YCDIHLGLYVIRGENVVLIGELDLEREELPPHMTRVSEAEIRRAQKAEREATDLKGTMRK RMEFLDLD NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtcttgggcaggcccagaagatatttacctctctacttctcttgccaactatcttgat aagaagcttcttgtgctcctacgagatggccgaaagctcatgggattacttcgttctttt gatcaatttgccaatgctgtccttgaaggtgcatgcgaaagagttattgttggtgacctt tattgcgacatccacttgggtctatatgtgattcgtggggagaatgttgtcttaattgga gagctggatttggagagggaggagcttccaccacatatgactcgtgtttcagaagcagag attagaagggcgcagaaagcagaaagggaggcaacagatctaaaaggtacaatgaggaaa agaatggagttccttgatttggactag

DBGET integrated database retrieval system