Populus trichocarpa (black cottonwood): 18096204 Help Entry 18096204          CDS       T01077                                  Name (RefSeq) replication factor C subunit 2   KO K10755   replication factor C subunit 2/4 Organism pop  Populus trichocarpa (black cottonwood) Pathway pop03030   DNA replication pop03410   Base excision repair pop03420   Nucleotide excision repair pop03430   Mismatch repair Brite KEGG Orthology (KO) [BR:pop00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     18096204    03410 Base excision repair     18096204    03420 Nucleotide excision repair     18096204    03430 Mismatch repair     18096204  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pop03032]     18096204    03036 Chromosome and associated proteins [BR:pop03036]     18096204    03400 DNA repair and recombination proteins [BR:pop03400]     18096204 DNA replication proteins [BR:pop03032]  Eukaryotic type   DNA Replication Elongation Factors    RFC (replication factor C)     18096204   DNA Replication Termination Factors    ELG1-RFC complex     18096204 Chromosome and associated proteins [BR:pop03036]  Eukaryotic type   Sister chromatid cohesion proteins    CTF18-RFC complex     18096204 DNA repair and recombination proteins [BR:pop03400]  Eukaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     RFC (replication factor C)      18096204   Check point factors    HRAD17(Rad24)-RFC complex     18096204 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RCF1-5-like_lid Rep_fac_C AAA_assoc_2 DUF3853 Motif Other DBs NCBI-GeneID:  18096204 NCBI-ProteinID:  XP_024449077 LinkDB All DBs Position 2:5634088..5638520 Genome browser AA seq 143 aa AA seqDB search METFSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEITSSRILHICNEEGLTLDGEA LSTLSSISQGDLCRAITYLQGAARLFGSSISSEDLISVSGAIRQEVTEALYEACKSGDFD LANKEVNNIIAEGYPVSQILAQA NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggaaactttctccaaagttacaagattcttcttcatatgtaattacatcagcaggatc atagagccacttgcgtcaagatgtgcaaaattcaggttcaagccactttcagaagaaatc acaagcagtcgtatattgcacatttgtaatgaagaaggcctcactctggacggagaggct ctctcaaccttgagttctatctcacaaggtgatctttgccgggctatcacatacttgcaa ggagctgctcgcctatttggatcgtcaatttcatccgaagaccttataagtgtatctggg gccattcggcaagaggttactgaggcactttatgaagcatgcaaaagtggtgactttgat ttggcgaacaaggaagtcaataatataattgcggaaggatatccagtatctcagatcctt gctcaggcatga

DBGET integrated database retrieval system