Populus trichocarpa (black cottonwood): 18098202 Help Entry 18098202          CDS       T01077                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pop  Populus trichocarpa (black cottonwood) Brite KEGG Orthology (KO) [BR:pop00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pop03041]     18098202   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pop04052]     18098202 Spliceosome [BR:pop03041]  Complex B   Other components    Complex B specific factors     18098202 Cytokines and neuropeptides [BR:pop04052]  Neuropeptides   Unclassified    18098202 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD OTU1_UBXL Ubiquitin_4 Crinkler Motif Other DBs NCBI-GeneID:  18098202 NCBI-ProteinID:  XP_024454473 LinkDB All DBs Position 4:21796273..21797788 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRPDKIRIQKWYTIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggtggtcttgaacgacagattgggcaagaaggtgagagtaaaatgcaatgaa gatgatacgataggggacctcaaaaagctggtggctgcccagaccggcacccgacccgat aagatccggatccagaaatggtacactatctacaaggaccatatcactctcaaagactac gaaattcatgatggcatgggcctcgagctgtactacaactga

DBGET integrated database retrieval system