Populus trichocarpa (black cottonwood): 18099655 Help Entry 18099655          CDS       T01077                                  Name (RefSeq) calmodulin-like protein 11   KO K02183   calmodulin Organism pop  Populus trichocarpa (black cottonwood) Pathway pop04016   MAPK signaling pathway - plant pop04070   Phosphatidylinositol signaling system pop04075   Plant hormone signal transduction pop04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pop00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     18099655    04070 Phosphatidylinositol signaling system     18099655    04075 Plant hormone signal transduction     18099655  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     18099655  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pop01009]     18099655   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pop04131]     18099655    03036 Chromosome and associated proteins [BR:pop03036]     18099655   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pop04147]     18099655 Protein phosphatases and associated proteins [BR:pop01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      18099655 Membrane trafficking [BR:pop04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     18099655 Chromosome and associated proteins [BR:pop03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      18099655 Exosome [BR:pop04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    18099655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 EF-hand_FSTL1 SPARC_Ca_bdg EH Dockerin_1 SAPC2_N EF-hand_EFHB_C EF_EFCAB10_C RNA_pol_Rpb4 PA_Ig-like EF-hand_11 DUF5580_M EF-hand_STIM1 DUF7117 MinC_N_1 Motif Other DBs NCBI-GeneID:  18099655 NCBI-ProteinID:  XP_006383679 UniProt:  U5GGN6 LinkDB All DBs Position 5:complement(21924861..21926262) Genome browser AA seq 149 aa AA seqDB search MADSLTEEQVAEFREAFCLIDKDADGFITMEELATIVQSLDRRPTKEEIQDMICDVDLDG NGTLDFEEFLNIMGRKQKENVTEELKEAFKVFDRNQDGYISANELRQVMINLGERLTEEE AEQMIREADVDGDGLVSYEEFARMMMVAF NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagattctctgacagaagaacaggttgctgagttccgagaggccttttgcttgatc gacaaggacgcagatggtttcattacaatggaagaactggcaaccattgtccagtcattg gatagacgtcctacgaaagaagaaattcaagacatgatatgtgacgttgatcttgatgga aatgggacattggattttgaagagttcttgaatatcatgggaaggaagcagaaggaaaat gtcactgaggaattaaaagaagctttcaaagtttttgataggaaccaagacggatatatt tcggccaatgagctaagacaagtgatgataaatttgggagagagactgacggaggaagag gctgaacaaatgataagagaggctgacgtggacggtgatggtctagttagttacgaggaa tttgcaaggatgatgatggttgctttctga

DBGET integrated database retrieval system