KEGG   Populus trichocarpa (black cottonwood): 7457977
Entry
7457977           CDS       T01077                                 
Name
(RefSeq) LOW QUALITY PROTEIN: histidine-containing phosphotransfer protein 5
  KO
K14490  histidine-containing phosphotransfer peotein
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:pop00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    7457977
SSDB
Motif
Pfam: Hpt
Other DBs
NCBI-GeneID: 7457977
NCBI-ProteinID: XP_024440579
LinkDB
Position
14:complement(9246692..9248164)
AA seq 110 aa
MDLLSQLRGQIADFSAFLYREGFVDDQFTXKLQDESSPGFVVEVVSLFFEDCEKLVNNMA
KALEQQIVDFKQVDSHVHQLKGSSSSIGAARIQNVCIAFKTYCEGQNRDG
NT seq 333 nt   +upstreamnt  +downstreamnt
atggatcttctcagtcagttgcggggacagattgctgatttctcagcttttctctaccga
gagggttttgtggacgatcagtttacanngaagctgcaagatgagagcagtcctggtttt
gtggtggaagtggtgtctcttttctttgaagattgtgagaagctcgttaacaatatggcc
aaagctttagaacagcagattgtagatttcaagcaggtagattctcatgttcatcaattg
aagggtagtagttctagcattggtgcagcaagaattcaaaatgtctgcattgccttcaag
acttactgtgaaggccaaaaccgtgacgggtaa

DBGET integrated database retrieval system