Populus trichocarpa (black cottonwood): 7458663 Help Entry 7458663           CDS       T01077                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pop  Populus trichocarpa (black cottonwood) Brite KEGG Orthology (KO) [BR:pop00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pop03041]     7458663   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pop04052]     7458663 Spliceosome [BR:pop03041]  Complex B   Other components    Complex B specific factors     7458663 Cytokines and neuropeptides [BR:pop04052]  Neuropeptides   Unclassified    7458663 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Ubiquitin_4 Rad60-SLD Motif Other DBs NCBI-GeneID:  7458663 NCBI-ProteinID:  XP_002315305 UniProt:  B9HUF6 LinkDB All DBs Position 10:20740542..20742014 Genome browser AA seq 73 aa AA seqDB search MLEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRAEKIRIQKWYTIYKDHITLRDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgttggaggtggtgttgaacgaccgtttgggaaagaaagtgagagtgaagtgcaacgac gacgacaccatcggtgacctcaagaagctcgtggcggcacagaccggtacccgggctgag aagatccggatccagaagtggtacaccatttacaaagaccatattaccctcagggattac gagattcatgatggcatgggcctcgagctctactacaactaa

DBGET integrated database retrieval system