Populus trichocarpa (black cottonwood): 7461583 Help Entry 7461583           CDS       T01077                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism pop  Populus trichocarpa (black cottonwood) Brite KEGG Orthology (KO) [BR:pop00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pop03036]     7461583 Chromosome and associated proteins [BR:pop03036]  Eukaryotic type   Nucleosome assembly factors    Histones     7461583 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF CBFD_NFYB_HMF Histone CENP-S TFIID-31kDa Motif Other DBs NCBI-GeneID:  7461583 NCBI-ProteinID:  XP_002324473 UniProt:  A0A3N7G994 LinkDB All DBs Position 18:11335391..11335810 Genome browser AA seq 92 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRLSGLIYEETRGVLK IFLENVIRDAVTYTEHARRKTVTAMDAVYAFD NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgtcagggagaggaaagggaggtaagggattgggaaagggtggagccaagaggcatcgt aaggttcttcgtgataacatccagggtatcaccaagcctgcgatccgtcgtctggctagg cgtggtggagtcaagcgtctcagtggtcttatatacgaggagaccagaggtgtcctcaag atcttcttggagaatgtgattcgtgatgccgtcacctacactgagcacgctcgccgcaaa acagtgactgctatggatgctgtgtatgctttcgactaa

DBGET integrated database retrieval system